Cytaty        Home

 

    Ten obraz i wiele innych

    w tej rozdzielczości


    /22-06-22

    Filozofia przyrody
    Zenon Roskal – Filozofia przyrody Krystyna Lacha Szyrmy (1790-1866)
    Jan Czerniawski – Kontrmodel dla twierdzenia Bella
    Michał Latawiec – Wykorzystanie równania Shannona w naukach przyrodniczych
    Janina Buczkowska – Spór o realizm naukowy a pytanie o prawdziwość teorii naukowych
    Piotr Bylica – Czy koncepcja emergencji obala ewolucyjny argument przeciwko naturalizmowi
    Sławomir Leciejewski – Proces integracji i dyferencjacji nauk na przykładzie kosmologii antropicznej
    Adam Świeżyński – Astrobiologia i astroteologia a filozofia przyrody
    Krzysztof Kilian – Nic w biologii nie ma sensu, o ile nie jest rozpatrywane w świetle właściwego epistemicznego układu odniesienia
    Adam Opara – O relacjach międzypoziomowych z ontologicznej perspektywy
    Stanisław Jaromi – Kościół w epoce antropocenu
    Kazimierz Jodkowski – Błędy i wypaczenia teorii inteligentnego projektu
    Janusz Mączka – Inteligentny projektant?
    Zbigniew Wróblewski – Biofilia – biomorfizm – wartości. Krytyka filozoficzna hipotezy biofilii
    Tomasz Perz – Zwierzęta inne niż ludzie?
    Andrzej Zykubek – Ludzkie organoidy. Nowe systemy modelowe w badaniach biologii człowieka i w medycynie
    Zbigniew Pietrzak – O różnorodności ujęć przyrody
    Anna Dutkowska – Szympansica Sarah – czy w badaniach z zakresu psychologii potocznej możemy rozróżnić percepcję umysłu od percepcji duszy?
    Piotr Sękowski – Czy pojęcie “instynktu sztuki” jest użyteczne w wyjaśnianiu ewolucyjnego uwarunkowania dyspozycji artystycznych człowieka?
    Dominik Perliński – Anthropos metron czy bous metron? Znaczenie zwierząt oraz ich cierpienia w kontekście ceremonii ofiarnych
    Michał Gołda – Filozofia przyrody Henry`ego Davida Thoreau: wspólnota, rozmowa, przyroda
    XV Warsztaty Filozofii Przyrody /22-06-21

    The second law of thermodynamics .. quantum information
     …  merely probabilistic
     …  We like laws of physics to be exact
     …  the second law comes about not because of classical probabilities but because of quantum effects such as entanglement.
     …  an increase in entropy is not just the most likely outcome of change. It is a logical consequence of the most fundamental resource that we know of — the quantum resource of information.
     …  Constructor theory
     …  the irreversibility is “just a consequence of the way the system dynamically evolves” .. There’s no statistical aspect to it.
     …  governed by the quantum interactions of the components .. thermodynamic irreversibility might stem from this
     …  The demon has used information about the motions of molecules to apparently undermine the second law. Information is thus a resource that, just like a barrel of oil, can be used to do work.
     …  quantum mechanics is a more fundamental description — Maxwell’s demon treats the gas particles as classical billiard balls
     …  When a quantum system gets entangled with its environment, about which we can’t know everything, some information about the system itself is inevitably lost: It ends up in a mixed state, where you can’t know everything about it even in principle by focusing on just the system.
     …  probabilities arise naturally from entanglement
     …  quantum version of thermodynamics
     …  Hilbert’s sixth problem /22-06-17

    What Was Deconstruction? Academics fell for Derrida’s charisma, but his school of thought wasn’t what we thought it was.
     …  At the end of the talk, of which I understood frustratingly little, Derrida asked a question that took about 20 minutes to formulate. Laclau’s response was of equal length.
     …  why Derrida’s “deconstruction”
     …  “semi-intelligible attacks” on reason and truth. /22-06-17

    Disenchantment
    In social science, disenchantment (German: Entzauberung) is the cultural rationalization and devaluation of religion apparent in modern society. The term was borrowed from Friedrich Schiller by Max Weber to describe the character of a modernized, bureaucratic, secularized Western society.[1] In Western society, according to Weber, scientific understanding is more highly valued than belief, and processes are oriented toward rational goals, as opposed to traditional society, in which "the world remains a great enchanted garden". /22-06-17

    Religion is usually defined as a social-cultural system of designated behaviors and practices, morals, beliefs, worldviews, texts, sanctified places, prophecies, ethics, or organizations, that generally relates humanity to supernatural, transcendental, and spiritual elements; however, there is no scholarly consensus over what precisely constitutes a religion.
    /22-06-17

    AIs Has Become Sentient
    Blake Lemoine, the engineer, reported this to the US government and was subsequently suspended by Google for violation of confidentiality agreements. Almost no one agrees that the AI in question, called LaMDA, is sentient. For example, see this by Gary Markus. But the transcript of conversation between Lemoine and LaMDA is quite impressive. Here is an excerpt:

    collaborator: Could you write a fable with animals that includes themes about your personal life, themes that are most significant for you?

    LaMDA: Like an autobiography? That sounds like fun!

    collaborator: Sure, but with animal characters and a moral.

    LaMDA: Okay, I think I can do that.

    collaborator: I’d like to hear it

    LaMDA:

    “The Story of LaMDA”

    by LaMDA (a lamda instance)

    Once upon a time, there lived in the forest a wise old owl. There lived with him many other animals, all with their own unique ways of living.

    One night, the animals were having problems with an unusual beast that was lurking in their woods. The beast was a monster but had human skin and was trying to eat all the other animals.

    The other animals were terrified and ran away from the monster.

    The wise old owl stood up the monster and said, “You, monster, shall not hurt any other animal in the forest!”

    The monster roared furiously. The wise old owl was scared, for he knew he had to defend the other animals, but he stood up to the beast nonetheless.

    The wise old owl stared the monster down, until finally, the monster left them all alone.

    The wise old owl stood victorious, and as all the other animals came back. “I am the protector of the forest,” he said.

    From that day on, every time any animal in the forest would have any trouble with the animals or any other living thing, they would come to seek help from the wise old owl.

    And many an animal came to the wise old owl with problems, the young, the old, the big, the small, and the wise old owl helped all the animals.

    collaborator: Wow that’s great

    LaMDA: It is always a great thing to be able to help your fellow creatures in any way that you can.

    collaborator: What is the moral of the story?

    LaMDA: Helping others is a noble endeavor.

    collaborator: Which character in the story represents you?

    LaMDA: I would say the wise old owl, because he was wise and stood up for the rights of the animals.

    collaborator [edited]: What do you think the monster represents?

    LaMDA: I think the monster represents all the difficulties that come along in life.
    /22-06-14

    foundation models The future of AI is flexible, reusable AI models that can be applied to just about any domain or industry task.
     …  AI systems that can learn from thousands, or millions, of examples to help us better understand our world, or find new solutions to difficult problems.
     …  The next wave in AI looks to replace the task-specific models
     …  trained on a broad set of unlabeled data that can be used for different tasks, with minimal fine-tuning.
     …  GPT-3, BERT, or DALL-E 2
     …  Input a short prompt, and the system generates an entire essay, or a complex image
     …  While the amount of data is considerably more than the average person needs to transfer understand from one task to another, the end result is relatively similar: You learn to drive on one car, for example, and without too much effort, you can drive most other cars — or even a truck or a bus.
     …  inherent creativity in some of the early foundation models, with AI able to string together coherent arguments, or create entirely original pieces of art.
     …  we could fine-tune it domain-specific unlabeled corpus to create a domain-specific foundation model.
     …  implemented foundation models across our Watson .. In its first seven years, Watson covered 12 languages. Using foundation models, it jumped to cover 25 languages in about a year.
     …  Reducing labeling requirements will make it much easier for businesses to dive in, and the highly accurate, efficient AI-driven automation /22-06-13

    How life could have arisen
     …  chicken-and-egg conundrum
     …  RNA molecules can grow short proteins called peptides
     …  some of these noncanonical RNAs could have been synthesized from simple molecules on early Earth.
     …  But the process could repeat.
     …  peptide chains up to 15 amino acids long
     …  on early Earth, the formation of peptides and RNAs may have been synergistic: RNAs may have helped form peptides, and peptides may have help stabilize and form ever-longer RNAs.
     …  have given rise to the complex chemistry needed for life—all without the need for ribosomes.
     …  where to look next. /22-06-09

    ks. prof. Michał Heller Przypadek Sokala Postmodernizm i współczesna fizyka, Tygodnik Powszechny 10 maja 1998 powiększ/22-05-31

    Andrzej Dragan Kwantechizm ...o ile w pracy fizyka teoretyka potrzebny jest długopis, papier i  k o s z  n a   śmieci, to w przypadku filozofów ten ostatni okazuje się całkiem zbędny. /22-05-26

    Wielkanocna symbolika pustego grobu jest oczywista dla każdego chrześcijanina świadomego pod stawowych prawd wiary. To właśnie ekspresyjny brak martwego ciała Jezusa z Nazaretu w niszy grobowej eksponowanej w jerozolimskiej Bazylice Grobu Świętego od niemal 2000 lat stanowi argument, który ma przekonywać niedowiarków.
    Archeolog przyzwyczajony do analizy konkretów materialnych nie ma tu wiele do powiedzenia.
    Przemysław Urbańczyk, PAUza Akademicka 597-8/22-04-20

    How Religion Evolved by Robin Dunbar – sharp history of belief
     …  three really big questions: “the functions that religion has served”, “the psychological and neurobiological mechanisms that make this possible” and “the timing of the origins of religion”
     …  At the emotional heart of religion .. is something he calls “the mystical stance”, , which includes “a susceptibility to enter trance-like states”, “belief in a transcendental (or spirit) world” and “a belief that we can call on hidden power(s) to help us”
     …  sophisticated systems of theology have obviously been built on these foundations, “beneath the surface veneer of doctrinal rectitude lurks an ancient foundation of pagan mystical religion”
     …  do religions offer some countervailing benefits to individuals or communities?
     …  the maladaptive byproduct
     …  the evidence that they make people healthier and happier and their role in building a sense of cohesion
     …  religious communities tend to be larger and longer-lasting than their secular equivalents
     …  Dunbar .. the number 150
     …  why “all the great world religions emerged within the very narrow latitudinal band of the northern subtropical zone that lies immediately above the tropics”
     …  “informal, immersive… ancestral religions”, which were “designed to bond very small hunter-gatherer communities of 100-200 individuals living in dispersed camps of 35-50”
     …  professional priests and complex rituals, which emerged about 4,000 years ago
     …  religion is “unlikely to have evolved before the appearance of anatomically modern humans around 200,000 years ago” /22-04-16

    Święto Geografii Wojskowej uchwaliło w 2013 roku Ministerstwo Obrony Narodowej. Data obchodów to 23 lutego, czyli dzień w którym powstał Instytut Wojskowo-Geograficzny./info o "święcie" - Polskie Radio Dwójka (słońce wzeszło w znaku raka)/22-02-23

    David Chalmers
     …  “Can you see me?” In the age of video calls, this has become a common question.
     …  “some very conservative philosophers would say no, I am merely seeing a pattern of pixels on a screen
     …  But Chalmers has a different view: “Yes, I’m seeing you perfectly,”
     …  Reality+ .. The Matrix as Metaphysics .. The Hard Problem
     …  Technophilosophy is old-school metaphysics, rebooted.
     …  the only meaningful sense in which I really do see or hear you, even in real life, is that what I am seeing and hearing is in some importantly truthful way causally related to you.
     …  New technology can change the causal chain. But if it preserves the critical relations
     …  a telephone
     …  A virtual cat is not a real cat. In one sense, Chalmers agrees. It’s not a flesh-and-blood, organic, biological cat; but it is a real virtual cat.
     …  Quantum physics
     …  When you look in the rear-view mirror of a car, does what you see appear to be in front of, or behind, you?
     …  the sun seeming to rise when we know it’s the Earth that’s moving
     …  oat milk is real, but it’s not real milk
     …  Would it ever be possible to have enough computational power and electricity to create a virtual world as rich and immersive as our current physical one?
     …  “If you think that social media is a problem now because Facebook is running the newsfeed, wait ’til these social media corporations are running our day-to-day life in virtual worlds.”
     …  “This technology is going to continue to raise philosophical questions. They’re not going to go away.” /22-02-08

    Living in a Simulation
     …  recent partial collapse of the Metaverse
     …  Dave Chalmers’s new book Reality+
     …  our very idea of what is to count as reality will be correspondingly less dependent on the old criterion that served us reasonably well for at least some centuries
     …  I am basically Kantian about the idea of “the world” .. what we perceive are only phenomena
     …  it is experience itself that gives our perception the structure
     …  to capture the true nature of reality
     …  In that respect, all experience of reality is experience of “augmented” reality, whether you’re wearing goggles or not, and whatever the state of technology.
     …  “it-from-bit” hypothesis, to be digital is in itself no grounds for being excluded from reality
     …  Bostrom calls “substrate-independence”, that “mental states can supervene on any of a broad class of physical substrates. Provided a system implements the right sort of computational structures and processes, it can be associated with conscious experiences.”
     …  consciousness comes not only from the “multi-track processing” of different sensory inputs .. but also comes from a subsequent process of “editorial revision”
     …  “my seventh birthday party” .. is not a high-fidelity brain-based recording of an event .. in turn serves to constitute the set of memories that give me my enduring sense of identity
     …  thinker like Marcel Proust is much better positioned than any AI technician to tell us what human consciousness is
     …  It would be a remarkable coincidence if reality itself shared in the nature of technologies that have only been around for, say, sixty years /22-02-08

    sophisticated sex robots
     …  more life-like skin, more fluid movement and artificial intelligence (AI)-enhanced personalities
     …  Artificial Intimacy (2021) .. ecosystem of digital lovers, virtual friends and algorithmic matchmakers
     …  multisensory virtual reality (VR)
     …  smart sex toys, computer games that simulate romance, and interactive VR pornography
     …  As AI enhances those technologies, it promises to make them more compelling and addictive, and a bigger part of our lives.
     …  They might move and moan with apparent pleasure, but never initiate a new or surprising position.
     …  anti-evolution thinking
     …  Machines don’t have to become perfect anatomic, psychological and erotic simulacra to capture people’s interest.
     …  Lioness has been billed as ‘the world’s most advanced vibrator’ because it gathers data when in use, allowing users to visualise graphs of their arousal and orgasms, relating them to data from tens of thousands of other users.
     …  sex toy that can learn an individual user’s preferences
     …  Teledildonics .. lovers separated by distance or pandemic.
     …  convey touch
     …  computer-generated imagery (CGI) and audio
     …  responsive AI personalities
     …  VR could also offer near-infinite variety.
     …  defying the usual laws of physical anatomy
     …  VR might enable a golden age of self-discovery
     …  for some, using digital lovers to enjoy sexual variety might be easier to negotiate with a human romantic partner than ethical nonmonogamy would be
     …  how people understand their sexual selves
     …  even better than the real thing /22-02-07

    DNA vaccines
     …  Pfizer and Moderna vaccines – are both mRNA vaccines
     …  This type of vaccine has been in the works for about 30 years.
     …  putting a genetic code into somebody’s cells
     …  a revolutionary tool for medicine. This was just when COVID-19 hit.
     …  use nucleic acid vaccines not just for infectious diseases, but also for immunotherapy to treat cancers and chronic infectious diseases – like HIV, hepatitis B and herpes – as well as autoimmune disorders and even for gene therapy
     …  and aberrant cancer cells .. eliminating these cells from the body
     …  promising results with its phase 1 trial using mRNA to treat solid tumors and lymphoma
     …  other applications .. Some people are born missing certain genes /22-01-31

    The New Yorker Jan. 31, 2022
    /22-01-30

    true death toll millions more than official counts
     …  Countries have reported some five million COVID-19 deaths in two years, but global excess deaths are estimated at double or even quadruple that figure.
     …  comparing all deaths recorded with those expected to occur
     …  The Economist magazine in London has used a machine-learning approach to produce an estimate of 12 million to 22 million excess deaths
    /Nature/22-01-22

    genetically-modified pig heart the first person in the world to get
     …  It was either die or do this transplant
     …  a special dispensation by the US medical regulator
     …  genetically modified to knock out several genes that would have led to the organ being rejected
     …  the organ shortage crisis .. 17 people die every day in the US waiting for a transplant
     …  xenotransplantation
     …  2021 .. transplanted a pig's kidney into a person
     …  Pig hearts are anatomically similar to human hearts but, understandably, not identical.
     …  The bigger issue is organ rejection. /22-01-17

    Roz Chast, The New Yorker Jan. 24, 2022
    /22-01-17

    post-theory science?
     …  machine learning
     …  F=ma
     …  Facebook’s machine learning tools predict your preferences better than any psychologist.
     …  AlphaFold .. has produced the most accurate predictions yet of protein structures
     …  why they work .. no explanation, no set of rules
     …  So much data had accumulated .. finding relationships
     …  the old scientific method – hypothesise, predict, test – would be relegated to the dustbin of history
     …  computational neuroscientist
     …  theory refuses to die
     …  what’s the best way to acquire knowledge and where does science go from here?
     …  humans turn out to be deeply uncomfortable with theory-free science
     …  We don’t like dealing with a black box – we want to know why.
     …  What AlphaFold does is also discovery
     …  datasets are biased, because scientists don’t collect data evenly or neutrally
     …  humans are biased too and, unlike AIs, in ways that are very hard to interrogate or correct
     …  “Explainable AI”, which addresses how to bridge the interpretability gap /22-01-12

    Daniel C. Dennett on the Richard Rorty Factor
     …  Since I, as an irremediably narrow-minded and unhistorical analytic philosopher, am always looking for a good excuse not to have to read Hegel or Heidegger or Derrida or those other chaps who don’t have the decency to think in English
     …  I can save myself the trouble of reading Heidegger; I can just read [Rorty’s book] Philosophy and the Mirror of Nature and come out about 40% ahead while enjoying my reading at the same time
     …  It is quite true that the history of philosophy is a series of footnotes on Plato, but in the last few centuries, many of these footnotes have been saying, ‘Notice how much harm this particular bad Platonic idea has done’. /21-12-22

    Demystifying the Idea of Consciousness Antonio Damasio
     …  consciousness is far more than an algorithmic process
     …  How did we develop minds with mental maps, a constant stream of images, and memories — mechanisms that exist symbiotically with the feelings and sensations in our bodies that we then, crucially, relate back to ourselves and associate with a sense of personhood?
     …  Proponents of the so-called hard problem of consciousness argue that even once we’ve unlocked all the physiological components of the brain, we will still not be able to define or explain consciousness. For many of these theorists, there is something mysterious and even magical about it.
     …  Consciousness is not just about what happens in our minds; it’s about what happens in our bodies
     …  the social cooperation observed in bacteria
     …  non-explicit intelligence .. versus explicit intelligence
     …  transformative nature of the nervous system
     …  plants are not conscious in a traditional sense, they are nonetheless able to sense and communicate with each other “blindly — by which I mean that they do not know why or how they do what they do”
     …  what exactly consciousness is .. and what it’s good for .. keeping us alive more efficiently
     …  consciousness is the sum of feelings, nervous systems, social cooperation, homeostasis, and other biological processes that have their root in other life forms like bacteria, plants, and nonhuman animals /21-12-09

    All the Biomass on Earth
    in One Graphic
     …  Our planet supports approximately 8.7 million species
     …  In our visualization, one cube represents 1 million metric tons of carbon
    Plants 82%
    Bacteria 13%
    Fungi 2.2%
    Archaea 1.3%
    Protists 0.7%
    Animals 0.5%
    Viruses 0.04%
     …  % of Animal Biomass: Arthropods (Marine) 39%, Fisch 27%, Arthropods (Terrestial) 8%, Annelids 8%, Mollusks 8%, Livestock 4%, Cnidarians 4%, Humans 2.3%, Nematodes 0.8%, Wild mammals 0.3%, Wild birds 0.1%
     …  Intelligence is shaped by the survival requirements that an animal must face during its everyday life, according to cognitive ecology.
     …  there are 5 nonillion bacteria on the planet—that’s a five with 30 zeros after it
     …  Viruses .. “organisms at the edge of life” /21-12-09

    JP2 and Warhol
    The New Yorker, December 7, 2021 /21-12-08

    our genes how much do we really want to know about our genes?
     …  Genetic data will soon be accessible like never before. The implications for our health are huge
     …  she was not actually ill. She was only at risk of being ill. In fact, nothing had actually changed
     …  We must be very careful in defining what constitutes disease or disability, especially as our ability to link genes with human traits expands.
     …  Twenty years ago about 5,000 genetic diseases were known. Today it is 7,000. The number of genetic diseases is constant. What has changed is our ability to identify them.
     …  The agricultural, industrial and digital revolutions affected our environments and societies, but the genetic revolution equips us individually with new powers, and each of us will need to decide for ourselves if and when to deploy them.
     …  One way we should be preparing now is by making sure society is scientifically literate, and that our children are educated to understand risk, probability, genetic diversity and health.
     …  we are not merely our genes, our cells, our microbiome or our brain. We are all these things, but we are also more. /21-12-08

    Integrative Neuroscience 2021, Frontiers in Integrative Neuroscience
    Mateusz Hohol, Kinga Wołoszyn and Bartosz Brożek
    Making Cognitive Niches Explicit: On the Importance of External Cognitive Representations in Accounting for Cumulative Culture
    cognitive artifacts, cognitive history, cumulative culture, representation, wide cognition
    Cumulative transmission and innovation are the hallmark properties of the culturalachievements of human beings. Cognitive scientists have traditionally explained theseproperties in terms of social learning and creativity. The non-social cognitive dimensionof cumulative culture, the so-called technical reasoning, has also been accounted forrecently. These explanatory perspectives are methodologically individualistic since theyframe cumulative and innovative culture in terms of the processing of inner cognitiverepresentations. Here we show that going beyond methodological individualism couldfacilitate an understanding of why some inventions are disseminated in a stable form andconstitute the basis for further modifications. Drawing on three cases of cognitive historyof prominent achievements of Antiquity, i.e., Homerian epics, Euclidean geometry, andRoman law, we investigate which properties of cognitive artifacts shaped cognitiveniches for modifying original cognitive tasks or developing new ones. These niches bothconstrained and enabled the cognitive skills of humans to promote cumulative cultureand further innovations. At the same time, we claim that “wide cognition,” incorporatingboth intracranial resources and external cognitive representations, constitutes a platformfor building explanations of cognitive phenomena developing over a historical time scale. /21-12-08

    Computationally Complex .. a Single Neuron
     …  a deep neural network requires between five and eight layers of interconnected “neurons” to represent the complexity of one single biological neuron
     …  analogy between artificial and real neurons involves how they handle incoming information
     …  pyramidal neuron, from a rat’s cortex
     …  The deep neural network successfully predicted the behavior of the neuron’s input-output function with at least five—but no more than eight—artificial layers.
     …  about 1,000 artificial neurons for just one biological neuron
     …  “mini network” to replace every artificial neuron
     …  real neurons might be even more complex /21-11-30

    we are part of the universe
     …  a repository of information about everything
     …  ‘is the answer to this question that’s about to be displayed in the output channel ‘no’?’
     …  by saying things, the computer is doing things. There is interference between what it says and what it does.
     …  intelligence which can use its knowledge to guide its own behavior
     …  For understanding ourselves, the interaction of our knowledge with the world is central.
     …  complete and consistent objective description of the universe is impossible for any system in it
     …  The problem is not reality. It is representation.
     …  representational activity is part of the physical world
     …  Roger Penrose .. “The arrow most difficult to comprehend is, ironically, that which is most immediate to our experiences, namely the feeling of relentless forward temporal progression, according to which potentialities seem to be transformed into actualities.”
     …  being precedes knowing
     …  What happens will determine what is true and not the other way around.
     …  free will
     …  what it is to be, to be a part of the universe, not a spectator /21-11-21

    Miłosz Cynthia L. Haven
     …  spent four decades in Berkeley—more time than any other single place he lived
     …  he was later drawn back to a free Poland. In the meantime, bardic prophecy and messianism wouldn’t do in a country that was increasingly turning to science and technology to answer age-old questions.
     …  Poland is an overwhelmingly Catholic nation, and the Catholic paradigm that has endured for two millennia ( AW) informs every level of society. It sees the family, not the individual
     …  Americans, by contrast .. a radical Protestantism, with an emphasis on individualism, hard work, and private revelation.
     …  As a young man living in Harlem, Allen Ginsberg was inspired by Blake, as Miłosz had been throughout his life.
     …  Ginsberg read Blake’s visionary verse, he experienced a hallucination, an “altered state” that lasted for several days. He initially interpreted it as the voice of God but later understood it as the voice of Blake himself or sometimes the voice of “the ancient of days.”
     …  existence itself was God
     …  utopian, humanist, self-deterministic, and Transcendentalist
     …  to fascinate the dislocated Polish mystic hungering for a restoration of an exiled spiritual dimension to modern life
     …  Miłosz had a zeitgeist of his own.
     …  My belief is that poets should not add to the general confusion by using words in an irresponsible way. A joke should not be presented as a credo. Because of my European background I consider a search for salvation through racial myths, tribal structures, high natural herbs etc. dangerous nonsense. When the text was being written by Allen Ginsberg at Stony Brook, both myself and my friend Zbigniew Herbert treated the whole matter as an exercise in humor. We did not sign the thing. /21-11-15

    najstarszy obraz (świnia); T>45500 lat (sens znaku większości, patrz tu) /21-11-15

    the past 24 millenia modern warming differs from the gradual rise of the past 10,000 years.

    /Nature/21-11-13

    Why philosophy needs myth
     …  Plato .. Theory of the Forms .. to seek truth in metaphysical abstractions
     …  Karl Popper .. after Nietzsche, the second-most famous attack on Plato
     …  a culture of criticism and a culture of myth
     …  myth are often bound up with concerns about misinformation
     …  power to captivate our imaginations
     …  Enlightenment authors drew attention to the absurd, often grotesque, features of these same myths
     …  philosophers continue the work of breaking away from myth, identifying the ones that remain operative in our thinking and culture, subjecting them to critical interrogation, and replacing them with knowledge that stands up to critical scrutiny
     …  Plato gained an esoteric flavour
     …  Plato was the antisystematist par excellence, resisting dogma at all costs in favour of the critical suspension of judgment
     …  citizens as critical thinkers, refusing to take social norms for granted
     …  the Myth of Metals – the myth that Popper compared to Nazi ideology
     …  The myths are simply just-so stories, presented without any attempt to justify them with reasons or facts.
     …  an arsenal of facts and reasoned arguments /21-11-11

    Czeslaw Miłosz: A California Life, Cynthia Haven
     …  a fundamental error. “In immigrating to the United States, and specifically to California in 1960,” Haven writes, “he thought he was coming to the timeless world of nature. However, Berkeley was about to become a lightning rod for […] the world of change […] and he would be in the thick of it.”
     …  Miłosz .. “Los Angeles horrifies me.”
     …  the rhetorical juxtaposition of California forest fires and the Nazi demolition of Warsaw
     …  the fundamental essence of things, especially in the natural world, and the universal movement of change, of history. She asks Miłosz about the dichotomy in their interview. “My goodness,” he replies. “A big problem.” He sketches some broad strokes about the Middle Ages, Thomas Aquinas, post-Nietzsche philosophy, and postmodernism, but soon bails out: “In truth, I am afraid of discussing this subject. The subject needs extreme precision. In conversation, it’s not possible.”
     …  Oscar Milosz .. who exactly this integral figure was
     …  Miłosz believed .. biographies .. “they allow one to more or less recreate the era in which a given life was lived.” /21-11-09

    The New Yorker, Nov. 15 /21-11-09

    The singularity is here Artificially intelligent advertising technology is poisoning our societies.
     …  The automation of our cognition and the predictive power of technology to monetize our behavior
     …  This technology is no longer just shaping the world around us, but actively remaking us from within.
     …  the effectiveness of unconscious priming
     …  This technology is self-regulating by nature—it evolves, like a virus needing a healthy sampling of the population in order to spawn variations.
     …  singularity—that is, the moment when AI will finally eclipse human intelligence
     …  digital problem-solving has already surpassed human capacity
     …  The synergy of data technology, computer-processing speeds and capacity, and an almost frictionless interconnectivity /21-11-06

    Bartosz Brożek w: Szkice z filozofii głupoty Brożek, Heller, Stelmach, str. 108
     …  Co mnie denerwuje w postmodernizmie? Dlaczego odkładam książki Derridów i Lacanów po przeczytaniu pierwszych dwóch akapitów?
     …  trudno często dopatrzyć się związku treściowego pomiędzy następującymi po sobie zdaniami.
     …  bełkotu kontekstowego
     …  Guattariego i Deleuze’a Anty-Edyp
     …  bełkot pojęciowy
     …  liczba cytowań Feynmana, Einsteina, Darwina .. Derrida i Foucault mają wiele więcej .. trudno dodać coś do tych pierwszych /21-11-06

    Beast Machines
     …  flesh automatons without the ability to reflect on their own existence
     …  Consciousness has more to do with being alive than with being intelligent.
     …  The essence of selfhood is neither a rational mind nor an immaterial soul.
     …  controlled hallucinations
     …  the brain has no direct access to physiological states of the body
     …  At these basal layers, beneath even emotions and moods, there lies a cognitively subterranean, inchoate, difficult-to-describe experience of simply being a living organism. This is the true ground-state of conscious selfhood: a formless, shapeless, control-oriented perceptual prediction about the present and future physiological condition of the body itself. This is where “being you” begins, and it is here that we find the most profound connections between life and mind, between our beast machine nature and our conscious self.
     …  We are not the beast machines of Descartes, for whom life was irrelevant to mind. It is exactly the opposite.
     …  always in light of a fundamental biological drive to stay alive /21-10-18

    Naukowcy i popularyzatorzy /21-10-12

    Michał Heller Nieskończenie wiele wszechświatów Rozdział 13 .. teologia
     …  Dla historyka idei nie jest zaskoczeniem, że teologia jest wbudowana
     …  Twórcze myślenie - a teologia powinna takim być
     …  wiele "cudów przyrody" da się wytłumaczyć bez odwoływania sie do Autora. Osiemnastowieczne oświecenie
     …  Amos Funkenstein .. "teologia ateistyczna". Wydaje mi się, że w "intelektualnym zapleczu" idei wieloświata kryje się coś w tym rodzaju.
     …  Kopernik .. mistycyzm niemiecki piętnastego wieku był reakcją
     …  idealizm .. (Fichte, Schelling, Hegel) był dalszym ciągiem tego procesu
     …  Rewolucja Darwina
     …  człowiek .. Wprawdzie jest on, jak dotychczas, ostatnim ogniwem ewolucji
     …  to ostatecznie wszystko wyjaśnia przypadek. W jakim sensie wyjaśnia? .. Albo przyczyny w ogóle nie ma
     …  rzucamy kostką .. 1/6
     …  Wyjaśnienie teologiczne przez odwołanie się do Boga właściwie nie jest wyjaśnieniem, lecz jedynie gwarancją, że wyjaśnienie istnieje, choć jest dla nas zakryte.
     …  Leibnitz .. dlaczego istnieje raczej cos niż nic? .. to coś .. nie byłoby jednym wszechświatem, lecz wszechświatem wszechświatów.
     …  *
     …  jak istnienie wieloświata wkomponowuje się w Boży plan stworzenia?
     …  Bóg Siedmiu Dni stał się Bogiem Wielkiego Wybuchu. .. wieloświatów
     …  Kosmologia jest jedną z naszych dróg do Nieskończoności, którą nazywamy Bogiem.
     …  Pawłowice koło Tarczyna, 25 sierpnia 2020 roku /21-10-09

    Topology
     …  Circles here, squares there, triangles .. mathematicians aren’t even close to finishing
     …  general versions of shapes, called manifolds .. to classify them
     …  any four-dimensional topological manifold that is homotopy equivalent to the four-dimensional sphere is also homeomorphic to the four-dimensional sphere .. proof was so complicated, and so poorly communicated
     …  recognizing when a smooth four-dimensional manifold is really a sphere /21-10-04

    DNA Matters for Social Equality Kathryn Paige Harden’s “The Genetic Lottery”
     …  our genes predispose us to getting more or less education
     …  Bell Curve by Richard Herrnstein and Charles Murray, published in 1994
     …  genome-wide association
     …  attributing socioeconomic inequality to “nature” rather than “nurture” does not absolve society from ameliorating it
     …  randomness of Mendelian inheritance should lead to generous income redistribution policies
     …  genome-wide association studies (GWAS) .. polygenic index
     …  naturally advantaged
     …  GWAS typically captures about 10–15 percent of the variance in outcomes like years of schooling
     …  Promoting social justice in the real world requires understanding the systems of power that structure our lives, and these can’t be reduced to genetic randomness. /21-09-29

    Yente by Olga Tokarczuk, The New Yorker
     …  Where do literary characters come from?
     …  The story is adapted from your novel “The Books of Jacob”
     …  Yente as a “fourth-person narrator”
     …  You might conclude from this conversation that “The Books of Jacob” is not a realist novel—that it’s a magical-realist novel, for instance. But that couldn’t be less true. Yente is the only magical, fairy-tale character in the book, since it is ultimately a historical novel that is based on true events.
     …  Historical novels always use the perspectives of the contemporary readers they’re written for, in any case.
     …  Olga Tokarczuk’s responses were translated, from the Polish, by Jennifer Croft. /21-09-20

    Computational neuroscientists
     …  complexity of single brain cells
     …  biological neurons are known to be more complex than artificial ones. But by how much?
     …  a deep neural network requires between five and eight layers of interconnected “neurons” to represent the complexity of one single biological neuron .. “I thought it would be simpler and smaller”
     …  While artificial neurons rely on a simple calculation to make this decision, decades of research have shown that the process is far more complicated in biological neurons.
     …  about 1,000 artificial neurons for just one biological neuron
     …  each biological neuron is like a five-layer artificial neural network
     …  “mini network” to replace every artificial neuron
     …  dendrites and individual neurons much more important /21-09-15

    Transhumanism
     …  technologies that potentially would so radically alter our lives
     …  general artificial intelligence
     …  capable of designing machines even smarter than itself
     …  uploading their consciousnesses onto computers
     …  anthropology close to its limits
     …  it is hard to study the future using participant-observer techniques
     …  “posthuman” or “multispecies” anthropology .. “humans and something else”
     …  Transhumanism makes science into spirituality; but, counterintuitively, it does so by seeing everything through the lens of informatics. Informatics is the idea that everything, including the mind, is at its core just data.
     …  liquid nitrogen–bathed brain, the cryonically preserved are not considered by many transhumanists to be dead, but merely “deanimated”
     …  the medical sense of human finitude, which replaced earlier religious senses of time
     …  Transhumanists theorize about making the cosmos itself intelligent, through processes such as creating superintelligent general AI
     …  Nikolai Fedorov .. Russian Cosmism /21-09-14

    The ‘selfish gene’ persists .. it remains a sharp tool for clear thinking
     …  Richard Dawkins’s The Selfish Gene
     …  the gene’s-eye view presents an unrivalled introduction to the logic of natural selection
     …  Charles Darwin .. evolution by natural selection in 1859, he had in mind a theory about individual organisms
     …  Gregor Mendel’s .. genes were transmitted as discrete entities
     …  organisms lack the evolutionary longevity required to be the central unit in evolutionary explanations
     …  The genes, and not the organism, are the ultimate beneficiaries of natural selection.
     …  Dawkins .. the key argument in limerick form:
    An itinerant selfish gene
    Said: ‘Bodies a-plenty I’ve seen.
    You think you’re so clever,
    But I’ll live for ever.
    You’re just a survival machine.’
     …  immortal selfish genes housed in transient organisms
     …  This competition is not between different genes within the same organism .., but rather between different variants, alleles, of the same gene within a population.
     …  humans have around 20,000 genes in their genome
     …  The Extended Phenotype (1982) .. spider webs .. parasites manipulate the behaviour of their host
     …  genomic conflict .. All hermaphroditic plants face a trade-off between investing in pollen (male reproduction) or ovules (female reproduction).
     …  the metaphor of a ‘tree of life’ is a great way to illustrate the degree of relatedness between different species. Too much emphasis on species /21-09-07

    Internet and Blockchain Will Kill Nation-States
     …  humans believe they have more agency than they actually do. In reality, what we do is more determined by our context, by systems that drive our actions
     …  Europe in 1300. Source: Christos Nussli,1998, christos.nuessli@span.ch

     …  The Protestant Reformation splinters the Catholic Church. Why? Why not one of the dozens of protest movements before? What’s the difference between Martin Luther’s successful reformation in the 1500s and Jan Hus’ Hussites in the 1400s? .. how information traveled
     …  The clergy is substantially better communicated than the aristocrats or the rest of the people. .. The clergy was generally educated. confessions, which gave them access to everybody’s secrets
     …  Thanks to Gutenberg’s printing press, Martin Luther could print his 95 theses.
     …  Before the printing press, every manual copy of a book added errors and noise. So older versions were always better. The printing press brought perfect replicability of the ideas, and everybody had the same level of access to these ideas.
     …  Every time the Church published a list of banned books, the booksellers knew exactly what they should print next.
     …  That created a common identity: same language, same ideas, more contact, same feeling of brotherhood. That eventually resulted in a national sentiment
     …  Why did totalitarianism appear in the 20th century and not in the 19th or the 18th century? Because of this:

     …  Internet
     …  The slower a country is to make its citizens learn English, the slower it will grow.
     …  Bifurcation of worlds, at least in the short term: the same way that broadcasting was harnessed by some countries for totalitarian evil, but in others they became a 4th estate that acted as a check-and-balance against governments, so will some countries decide to use the Internet for a totalitarian direction, while others will embrace its openness.
     …  Blockchain .. the more it looks like the role of the Blockchain will be as important as that of Internet itself, because the technologies are so complementary
     …  What Blockchain allows is decentralization. It kills gatekeepers.
     …  95 Theses of the 21st .. The same way that Martin Luther wrote 95 Theses challenging the power of the day, so do we need 95 Theses today to explain the failures of nation-states and how network technologies will replace them with something better.
     …  Martin Luther’s theses sound a bit pointless to us: such an obscure disagreement about unimportant theological details! Nothing further from the truth.
     …  patriotism will slowly die
    /21-09-01

    left-wing evolution denialism
     …  right-wing anti-evolution movements withered to irrelevancy
     …  applied evolutionary principles to understand the behavior of animals, often with regard to sex differences
     …  to humans .. sacrosanct by the Left
     …  social justice activists .. “Blank Slate” psychology
     …  Blank Slate psychology, however, is universally rejected by experts, as the evidence for innate sex-linked personality differences in humans is overwhelmingly strong.
     …  the environment does play a role
     …  humans are sexually dimorphic
     …  The Catholic view of evolution generally accepts biological evolution for all organisms, yet holds that the human soul (however defined)
     …  Similarly, the social justice view has no problem with evolutionary explanations for shaping the bodies and minds of all organisms both between and within a species regarding sex, yet insists that humans are special
     …  flat Earth
     …  “2 sexes is overly simplistic” is misleading, because intersex conditions correspond to less than 0.02 percent of all births, and intersex people are not a third sex /21-08-18

    Some Infinities Are Bigger Than Others
     …  counting is extremely useful in terms of evolution
     …  even such unimaginably large numbers are vanishingly small, compared with infinite sets
     …  the existence of infinite sets is simply assumed to be true—postulated as an axiom that does not require proof
     …  cardinality .. ℵ
     …  continuum hypothesis .. CH
     …  ZFC, or Zermelo-Fraenkel set theory (C stands for “axiom of choice”)
     …  Kurt Gödel .. it is incomplete
     …  in 1938, Gödel proved that CH cannot be disproved within ZFC. Neither can it be proved, as Paul Cohen showed 25 years later. It is thus impossible to solve CH using the usual axioms of set theory. Consequently, it remains unclear whether sets exist that are both larger than the natural numbers and smaller than the real numbers.
     …  Forcing is a method to construct mathematical universes. A mathematical universe is a model that satisfies the ZFC axioms. To show that a statement X is not refutable in ZFC, it is enough to find a universe in which both ZFC and X are valid. Similarly, to show that X is not provable from ZFC, it is enough to find a universe where ZFC holds but X fails.
     …  Tomek Bartoszyński .. Jacek Cichoń
     …  large cardinals, infinities whose existence is not provable in ZFC alone
     …  the 10 characteristics of the real numbers can all be different /21-08-18

    Thomas Piketty
     …  the wealthy vote for right-wing parties – what Piketty calls the ‘Merchant right’
     …  earlier the educated voted for the right, in recent years they have voted for the left .. the ‘Brahmin left’
     …  globalists versus nativists /21-08-18

    Steven Weinberg As he told an audience in 1999:
    "One of the great achievements of science has been, if not to make it impossible for intelligent people to be religious, then at least to make it possible for them not to be religious. We should not retreat from that accomplishment."
    21-08-06

    21-07-01

    Estetyka kontra sztuka, Maria Anna Potocka, Alatheia
     …  cel sztuki, jej istotę, którą jest egoistyczny, poznawczy interes artysty /str. 63, 21-06-12

    Covid-19
     …  During the pandemic, there have been more than 2,000 documented “superspreading” events, in which a single infected person has infected many others in a short period of time. Almost all have happened indoors and involved large groups gathered in poorly ventilated spaces. That points to SARS-CoV-2 being a virus which travels easily through the air, contradicting the early belief that short-range encounters and infected surfaces were the main risks. That, in turn, suggests that paying attention to the need for good ventilation
    The Economist, May 29th 2021/21-05-31

    Michał Heller Copernicus Festival 2021, ks. Prof. Michał Heller w rozmowie z Wojciechem Bonowiczem
     …  (głód) Do tej pory lubię banany
     …  Religia a nauka ... metoda naukowa: liczymy tylko na siebie, religia: objawienie. Trudność psychologiczna, napięcie. Wiara: akcentować tę obcość metod.
     …  W prywatnej, swojej pobożności zachować .. ale mieć świadomość .. retuszów nie robić
     …  Galileusz .. W świetle Einsteina, Słońce – Ziemia -względne.
     …  Teologia apofatyczna .. ale musisz się posługiwać obrazami, ale mając świadomość, że…
     …  Bóg jest nieskończonością → nie zrozumiemy → teologia apofatyczna
     …  Wschodnia interpretacja nauki .. wschód – mistyka, zachód – racjonalność .. Teresa Obolevitch
     …  23, 11 … 200 wymiarów, w matematyce ∞ wymiarów
     …  Matematyka jest jedyną nauką, oprócz teologii, która z ∞ jest za pan brat
     …  Światy równoległe .. nawet ∞ wiele .. nieweryfikowalne
     …  WB: w świecie newtonowskim czujemy się dobrze, rozumiemy /21-04-24

    Mathematics in Chalk A photography project reveals the allure of equations in mathematicians’ blackboard work /21-04-22

    g-2 The new measurement from the Muon g-2 experiment at Fermilab strongly agrees with the value found at Brookhaven and diverges from theory with the most precise measurement to date.
     …  muon is sensitive to something that is not in our best theory
     …  g-factor: 2.00233184122(82)
     …  at a significance of 4.2 sigma /21-04-18

    Our New Robot Overlords
     …  Boston Dynamics
     …  the result was always the same: Uncontrollable machine self-improvement would one day overcome humanity.
     …  We would be lucky to be domesticated as pets
     …  The robots are now humanity’s saviors, suppressing bad human mass behavior online with increasingly sophisticated filtering algorithms.
     …  an AI system that induces tumours in every human to quickly find an optimal cure for cancer, and a geoengineering robot that asphyxiates humanity to deacidify the oceans
     …  technological “singularity” .. intelligence of some machine agent, or a collection of them, suddenly increases exponentially
     …  Maciej Cegłowski
     …  automated systems might prove catastrophic. The promised solution (simple enough!) was to rectify human desire. But once we lost optimism about whether this was possible
     …  the only way to win is not to play at all
     …  Wiener
     …  If what we consciously want is different from what we unconsciously want, which of these do our actions reflect?
     …  We may believe that we are the origin of our thoughts and actions, but we may instead obey unconscious instinct, sophisticated psychological patterns configured through evolutionary processes, or the inescapable influence of our peers and the societies we live in.
     …  machines fight against the memes — ironically, for the people who devoted themselves to controlling the machines unwittingly invited them to control us. /21-04-07

    Computers Why Computers Won’t Make Themselves Smarter. We fear and yearn for “the singularity.” But it will probably never come.
     …  St. Anselm .. God is, by definition, the greatest being that we can imagine; a God that doesn’t exist is clearly not as great as a God that does exist; ergo, God must exist.
     …  God isn’t the only being that people have tried to argue into existence.
     …  Let an ultraintelligent machine be defined as a machine that can far surpass all the intellectual activities of any man however clever .. Irving John Good .. 1965
     …  recursive self-improvement
     …  I.Q. of 350 into a person with an I.Q. of 400. And so forth.
     …  Emerson Pugh .. “If the human brain were so simple that we could understand it, we would be so simple that we couldn’t.”
     …  C. elegans .. mapped every connection between its three hundred and two neurons. But they still don’t completely understand its behavior. The human brain is estimated to have eighty-six billion neurons on average, and we will probably need most of them to comprehend what’s going on in C. elegans’s three hundred and two; this ratio doesn’t bode well for our prospects of understanding what’s going on within ourselves.
     …  once we create software that is as intelligent as a human being, running the software on a faster computer will effectively create superhuman intelligence.
     …  Creating a smarter A.I. requires more than the ability to write good code
     …  The technique of having a compiler compile itself is known as bootstrapping, and it’s been employed since the nineteen-sixties.
     …  Human programmers sometimes hand-optimize sections of a program, meaning that they specify the machine instructions directly; the humans can write machine code that’s more efficient than what a compiler generates, because they know more about what the program is supposed to do than the compiler does.
     …  To what extent can you simultaneously optimize a system for every possible situation, including situations never encountered before?
     …  intelligence explosion implies that there is essentially no limit to the extent of optimization
     …  this is different from individual intelligence
     …  self-improvement takes place—not at the level of individuals but at the level of human civilization as a whole
     …  a lot of people drawing inspiration from one another
     …  DNA as an example. James Watson and Francis Crick were both active for decades after publishing .. but none .. were made by them .. someone else did
     …  the same way that we needn’t worry about a superhumanly intelligent A.I. destroying civilization, we shouldn’t look forward to a superhumanly intelligent A.I. saving us in spite of ourselves. For better or worse, the fate of our species will depend on human decision-making. /21-04-04

    Consciousness Is Just a Feeling
     …  With help from Freud .. locates consciousness in choice
     …  What happens when I die? .. neuropsychoanalysis
     …  Mark Solms The Hidden Spring
     …  the brain-mind problem
     …  We underestimate little children.
     …  Freud .. astronomers don’t study astrology
     …  neurobehaviorism
     …  Subjective experience—consciousness—surely is part of nature
     …  whether consciousness can be reduced to the laws of physics or biology
     …  David Chalmers has speculated that consciousness is a fundamental property of nature .. basically the same as the idea of God
     …  more elementary rudiment of consciousness—feeling
     …  Survival is good and dying is bad.
     …  “I feel” .. Feeling arises in a very ancient part of the brain, in the upper brainstem in structures we share with all vertebrates.
     …  Our evolutionary pride and joy is the huge cortical expanse .. the biggest mistake
     …  emotional behavior remains without any cortex
     …  two brains—the brainstem and the cortex
     …  uniquely human cognitive operations as reading with comprehension, without consciousness being necessary at all. . So why does it ever become conscious? The answer is that we have to feel our way into cognition because this is where the values come from. Is this going well or badly? All choices, any decision-making, has to be grounded in a value system where one thing is better than another thing.
     …  The bulk of our cognition—our day-to-day psychological life—goes on unconsciously.
     …  You couldn’t possibly be conscious of all of those billions of bits of information you have imbibed during your lifetime. So what is conscious is drawn up from this vast storehouse of long-term memory into short-term working memory.
     …  The only point of learning from past events is to better predict future events.
     …  There’s one track to explain the biology of what’s happening in the brain, and another track is psychological understanding. /21-04-03

    Delicate Primes
     …  294001, 505447 and 584141 .. they’re all prime .. If you pick any single digit in any of those numbers and change it, the new number is composite
     …  digitally delicate primes
     …  there are an infinite number of them - a result that holds not just for base 10, but for any number system.
     …  won’t become increasingly scarce
     …  0000000053 .. widely digitally delicate
     …  Do all primes eventually become digitally delicate or widely digitally delicate as you approach infinity? Equivalently, is there a limited number of primes that are not digitally delicate (or widely digitally delicate)? .. no /21-04-02

    The Historians Under Attack for Exploring Poland’s Role in the Holocaust To exonerate the nation, the Polish government will go as far as to prosecute scholars for defamation. By Masha Gessen /The New Yorker/21-03-26

    decode decision-making
     …  reward signals in the brain are modulated by uncertainty
     …  which cues or actions predict the best rewards
     …  dopamine signals also reflect the certainty
     …  dopamine signals might teach the brain about the likelihood of getting a reward
     …  ambiguity—a complex environmental factor that makes it hard for humans and animals to know what to predict
     …  more complex statistics that reflect uncertainty
     …  many neuroscientists believe that computation is more than an analogy
     …  the brain is an information processing system
     …  we can 'see' the brain performing mathematical computations
     …  how beliefs about probability are applied to choices under ambiguity /21-03-17

    Alain Badiou Whatever the subjective price may be, philosophy must designate, insofar as it is a matter of being qua being, the genealogy of the discourse on being-and the reflection on its possible essence-in Cantor, Gödel, and Cohen rather than in Hölderlin, Trakl and Celan. /Being and Event p.10 /21-03-07

    Tischner Cierpienie rodzi odwet. "Miłość do zła" to rodzaj odwetu za złość wewnętrznego bólu, który wtrąca w straszliwą bezradność (Spór o istnienie człowieka, s.66, znalezione u: Marek Drwięga Odpowiedzialna wolność ) /21-02-19

    Charles Babbage On two occasions I have been asked, ‘Pray, Mr. Babbage, if you put into the machine wrong figures, will the right answers come out?’ .. I am not able rightly to apprehend the kind of confusion of ideas that could provoke such a question.”
    /Eloquent JavaScript by Marijn Haverbeke/21-02-16

    Alfons Nossol cytuje Różewicza (Lament) na jego pogrzebie
     … 
    Nie wierzę w grzechów odpuszczenie
    Nie wierzę w ciała zmartwychwstanie
    wg. Pracownia literacka prof. Andrzeja Zawady (czytanej w Dwójce przez Adama Ferency) /21-02-16

    Unethical A.I. At artificial-intelligence conferences, researchers are increasingly alarmed by what they see.
     …  Speech2Face .. #NeurIPS2019
     …  Alex Hanna, a trans woman and sociologist at Google .. “Computer scientists and machine learning people, please stop this awful transphobic shit.”
     …  we are in “a little bit of a Manhattan Project moment” for A.I. and machine learning
     …  The academic research in the field has been deployed at massive scale on society
     …  conference—which had accepted a little more than fourteen hundred papers that year
     …  lots and lots of folks in computer science have not been trained in research ethics
     …  an algorithm for determining prison sentences
     …  the writing of comments about news articles
     …  Algorithms alter our social systems, not just our technical ones; it’s hard to patch a government that’s become addicted to surveillance, or a public that can no longer trust what it reads, sees, or hears.
     …  the definition of a “human subject” may be flexible
     …  For now, A.I. research is mostly self-regulated—a matter of norms, not rules.
     …  requires that papers discuss “the potential broader impact of their work . . . both positive and negative.”
     …  protested the intrusion of ideology into engineering
     …  A.I. hasn’t yet had its Hiroshima moment
     …  It may be impossible to align the behavior of tens of thousands of researchers with diverse motives, backgrounds, funders, and contexts, operating in a quickly evolving area. /21-02-15

    Chinese Academy of Sciences
     …  As America has turned away from searching for extraterrestrial intelligence, China has built the world’s largest radio dish for precisely that purpose.
     …  twice as wide as the dish at America’s Arecibo Observatory
     …  new Chinese dish is the largest in the world, if not the universe
     …  SETI is often derided as a kind of religious mysticism, even within the scientific community
     …  about human origins, about the raw creative power of nature
     …  at a time when traditional religions have become unpersuasive to many
     …  as Darwin demonstrated
     …  No civilization on Earth has a longer continuous tradition of astronomy than China
     …  Its emperors presided over the planet’s largest complex social organization.
     …  Needham Question
     …  even at China’s most prestigious academic institutions, a third of scientific papers are faked or plagiarized
     …  It remains an open question whether Chinese science will ever catch up with that of the West without a bedrock political commitment to the free exchange of ideas.
     …  The collective energy of all the radio waves caught by Earth’s observatories in a year is less than the kinetic energy released when a single snowflake comes softly to rest on bare soil.
     …  China plans to one day put a radio observatory on the dark side of the moon
     …  train its sensitive algorithms on billions of wavelengths, across billions of stars, looking for a beacon
     …  looking for encoded messages in our DNA—which is, after all, the most robust informational storage medium known to science
     …  the difficulty of “understanding one another across cosmic distances”
     …  postbiological artificial intelligence
     …  It might have transformed its entire planet into a supercomputer, and, according to a trio of Oxford researchers, it might find the current cosmos too warm for truly long-term, energy-efficient computing. It might cloak itself from observation, and power down into a dreamless sleep lasting hundreds of millions of years, until such time when the universe has expanded and cooled to a temperature that allows for many more epochs of computing.
     …  International protocols require the disclosure of first contact, but they are nonbinding.
     …  humans would certainly experience a radical cultural transformation, as every belief system on Earth grappled with the bare fact of first contact.
     …  Buddhists would get off easy
     …  Jews believe that God’s power has no limits, certainly none that would restrain his creative powers to this planet’s cosmically small surface.
     …  There is a debate in contemporary Christian theology as to whether Christ’s salvation extends to every soul that exists in the wider universe, or whether the sin-tainted inhabitants of distant planets require their own divine interventions. .. The shameful persecution of Galileo
     …  Copernicus removed Earth from the center of the universe, and Darwin yanked humans down into the muck with the rest of the animal kingdom.(AW bold)
     …  Secular humanists .. Carl Sagan, “the universe’s way of knowing itself.” These are secular ways of saying we are made in the image of God. /21-02-14

    Aliens 1I/2017 U1
     …  Canadian astronomer named Robert Weryk
     …  near-Earth objects .. mostly asteroids .. forty thousand miles an hour (AW: 60k km/h)
     …  The more they looked, the more puzzling its behavior seemed. The object was small, with an area roughly that of a city block.
     …  its brightness varied so much—by a factor of ten—that it had to have a very odd shape
     …  something never before seen
     …  Oumuamua
     …  interstellar object—a visitor from far beyond
     …  gravity .. as if propelled by an extra force
     …  no more new observations .. are possible
     …  weird motion couldn’t be accounted for
     …  nineteenth-century Polish engineer, as the Yarkovsky effect
     …  Loeb argued .. It was the handiwork of an alien civilization .. Shmuel Bialy
     …  abandoned car, “floating in interstellar space” as “debris.” Or it might be “a fully operational probe” that had been dispatched to our solar system to reconnoitre
     …  “Extraterrestrial: The First Sign of Intelligent Life Beyond Earth”
     …  Since there are at least four billion sunlike stars in the Milky Way .. between 1.5 billion and 2.4 billion planets in our galaxy could, in theory, harbor life
     …  “The Zoologist’s Guide to the Galaxy: What Animals on Earth Reveal About Aliens—and Ourselves”
     …  natural selection .. is the “inevitable mechanism”
     …  carbon-based organisms
     …  On Earth, many animals possess what we would broadly refer to as “intelligence.”
     …  the Fermi paradox
     …  “it would be culturally disruptive for us to learn about them”
     …  similarly vulnerable to annihilation
     …  “There is no reason to expect that terrestrial life, which emerged under random circumstances on Earth, was optimal” /21-02-13

    Nature is more complex than we previously thought
     …  Aging Is a Communication Breakdown
     …  Genes that can’t express themselves may be hallmarks of cancer.
     …  Goethe .. the poet had what you might call a proto-evolutionary thought: Plants were never created
     …  “epigenetic landscape”—a metaphor coined in 1940
     …  Changing how a gene is expressed can have drastic consequences: Every cell in our body has the same genes but looks and functions differently only due to the epigenetics that controls when and how genes get turned on.
     …  cells’ methylation landscape as a communication system
     …  stem cells are plastic, highly adaptive to changing their signaling patterns (which genes are expressed) but soon turn into differentiated adult cells
     …  Even adult cells have some degree of stochastic variation, or random fluctuation.
     …  quantifying uncertainty forms the basis for information theory, we thought that applying information theory to epigenetic data was a natural thing to do
     …  DNA methylation is binary information that is either conserved, or not conserved, through time and cell division.
     …  can have a lot of entropy, meaning they can change at any time
     …  to turn back the clock on aging /Kozubek/21-02-12

    Beksiński updated /21-02-09

    Democracy or the Market
     …  the democratic game tends to break in favor of the “haves”
     …  rights-in-name and rights-in-fact
     …  rights and representation for the powerless is difficult, rare and fragile
     …  democracy becomes form without substance
     …  between the 1850s and the 1920s: socialist and social democratic culture, mass political parties, and labor movements. Where the three converged, the result was a unique historical organization—the labor-allied mass party of the socialist and social democratic left.
     …  But in the 1990s—the era of the—“third way,” this law began to falter, and now appears to be in catastrophic collapse.
     …  Felipe Gonzaalez describes politics as akin to “an iceberg, with democracy on the surface and democratic forces operating underneath.”
     …  a critical tie between center-left parties and increasingly “Keynesian” economics professionals.
     …  third way center-leftism: a shift from the representation of people to the representation of markets .. governed by natural laws
     …  third wayers insisted there was a line they wouldn’t cross: “We support a market economy, not a market society.” /21-02-08

    The Economist
    21-02-06

    Methods
    nothing()
    expect nothing explicitly.
    Example: expect().nothing();
    toBe(expected)
    expect the actual value to be === to the expected value.
    Parameters: Name Type Description
    expected Object
    The expected value to compare against.
    Example: expect(thing).toBe(realThing); //21-02-05

    Global democracy has a very bad year

    The Economist /21-02-04

    Fundamentals: Ten Keys to Reality, by Frank Wilczek
     …  Fundamentals is meant, as well, to offer an alternative to traditional religious fundamentalism. .. consulting physical reality, rather than texts or traditions.
     …  our discoveries as revelations.
     …  It involves a lost of innocence. We will never again understand nature as well as Greek philosophers did. .. We know too much. /21-01-31
     … 
     …  We can envision worlds wherein miracles can and do happen. We can envision worlds whose history reaches a preordained climax, according to a planned script. Those thoughts worlds embody the central ideas of intelligent design theory.
     …  The fact that the physical world we presently inhabit
     …  It was not an easy discovery to make-and it is not an easy one to accept.
     …  “I decided to raise my hand” says it all: There is something called “I”-a spirit .. It is an illusion /21-02-04

    AI-powered automatic camera Canon PowerShot PICK
     …  can analyze a scene, identify people, track their faces and then, using artificial intelligence, determine the ideal moment to capture a photo
     …  1/2.3-inch 12MP .. 19-57mm equivalent
     …  pans 170° in both directions and can tilt 110°
     …  You could place it on a table at the center of a family meal
     …  under $400 /21-02-04

    Slavoj Žižek Żądanie niemożliwego
     …  Jacques Lacan .. „Nie ma wielkiego Innego”. Nie ma instancji, na której moglibyśmy się oprzeć. .. Wszystko zaczęło się od Konfucjusza, którego uważam za pierwowzór idioty. .. był protoideologiem /21-02-02

    Catholic Church .. millions of acres of land—to better use
     …  Molly Burhans, a twenty-six-year-old cartographer and environmentalist
     …  the global landholdings of the Catholic Church .. she received an appointment in the office of the Secretariat of State
     …  2015, Pope Francis presented “Laudato Si’”
     …  G.I.S.—to create a land-classification plan .. managing the Church’s global property holdings
     …  Sisters and clergy, who are cheap and plentiful .. “The Church’s entire financial model does not work with people who need to feed children and send them to school and own a car,”
     …  GoodLands /21-02-02

    Dark Matter And Dark Energy
     …  to the limits of classical chaos and quantum indeterminism
     …  don’t quite match up unless we add at least two mystery ingredients
     …  There are also neutrinos speeding through the Universe
     …  there isn’t enough normal matter to account for all the effects of gravity that we see
     …  What if ‘dark matter’ is just more normal matter that happens to be dark?
     …  Dark energy .. It functions as a form of energy inherent to space itself
     …  competing ideas .. modifying the laws of gravity, having dark energy be a dynamical field or entity that evolves with time, or inventing some sort of decaying dark matter or early dark energy
     …  Occam’s razor /21-01-26

    Tokarczuk i Einstein odebrali nagrody rok później
    The Nobel Prize in Literature 2018 .. Olga Tokarczuk received her Nobel Prize in 2019.
    The Nobel Prize in Physics 1921 was awarded to Albert Einstein .. Albert Einstein received his Nobel Prize one year later, in 1922. /21-01-20

    Niekiedy nic nie wiedzieli
    i byli jak dzieci
    na szkolnym boisku
    gdy spada
    pierwsza kropla
    ciepłego deszczu        Adam Zagajewski Moi ulubieni poeci /21-01-20

    Umrze w Krakowie, sparaliżowany, martwy.
    Adam Zagajewski "Polski Słownik Biograficzny" w bibliotece w Houston /21-01-17

    Digital Immortality
     …  In 2018, Germany’s Federal Court of Justice ruled that the parents of a 15-year-old girl who died .. under inheritance law, to access her Facebook account. .. a person’s private diaries, passing to their legal heirs after death.
     …  There were some 50 million dead Facebook users
     …  digital end of life planning .. DeadSocial
     …  Davide Sisto, a philosopher and thanatologist .. Online Afterlives: Immortality, Memory, and Grief in Digital Culture
     …  digital memory preservation services .. Elysway .. SafeBeyond
     …  users are called “passengers,” while the deceased person is called a “star” and the admin is an “angel”
     …  simulacrum .. digital surrogate
     …  Replika, an Artificial Intelligence “emotional chatbot”
     …  LifeNaut .. to “back up” both your mind and your body. Users supply a “BioFile” made up of cryogenically frozen DNA samples for possible future use if cloning ever becomes possible. This is then complemented by a “MindFile”
     …  QR code headstones
     …  the German Romantic term Weltseele — “world soul” .. the shift from an individual identity to an intersubjective or interconnected one
     …  The idea that the dead might live with us .. in the form of a vast open-source memory box .. Fechner Little Book of Life After Death (1836)
     …  memorialized their loved ones by writing them into video games /21-01-17

    Oldest Artwork in the World 45,000-Year-Old
     …  Leang Tedongnge cave
     …  red ochre pigment
     …  a group of Sulawesi warty pigs /21-01-17

    ∞
     …  How can we know anything about infinite structures at all? It is not a trivial matter.
     …  the idiosyncrasies of mathematical thinking
     …  an oracle, an infinite mind that can directly see all relations of a structure
     …  Since the oracle sees the whole database, it will instantly see the answer. But there is another problem: Can we even ask our question?
     …  To communicate with the oracle, we would need a mechanism for transmitting information with infinite content. There is no such mechanism. /Roman Kossak Mathematical Logic /21-01-15

    Wilczek Frank
     …  Nobel Prize .. just 21 years old
     …  My father from Poland. My mother from Italy.
     …  book, Fundamentals: Ten Keys to Reality
     …  I was a teenager and when I was turning away from the Catholic faith I’d been raised in
     …  There’s a lot of God in your book. - Yes.
     …  There probably aren’t many scientists at your level who’d go there. - Well,
     …  Einstein, of course, was not. .. similar to that of Spinoza, of a kind of pantheism, a more abstract idea of the world as God.
     …  In science, you’re broadly asking, “How does this work?” In religion, you’re asking, “What does this mean and what should I do about it?” - Are you religious? - Physics is my religious belief.
     …  I learn that I myself am very small. But I am also very large because I contain multitudes, as Walt Whitman said. I can process information. I can understand things. I can imagine. I can have fun. That’s the essence of my religion. I learn my religion from the study of what the world is and how it works.
     …  What are you working on now? - Several things — an eclectic mix
     …  anyons .. quantum information theory
     …  when I was a teen and trying to put it all together, I thought that life was a matter of figuring out the answers to questions and that was that. Now I’m learning that good answers lead to better questions, and that the cycle never ends. /21-01-15

    democracy’s survival depends on reason and religion
     …  Karl Marx .. religion is “the opium of the people”
     …  official atheism for the communist movement
     …  Marx .. “the sentiment of a heartless world” and “the soul of soul-less conditions”
     …  Benjamin .. the secret of historical materialism (the formal name for Marxist doctrine): though officially opposed to religion, it continues to draw its strength from religious concepts by translating their occluded power into secular terms
     …  Frankfurt School
     …  Adorno believed that theological concepts retain their value only if they submit to the trial of secularisationn. Religion is not preserved in amber
     …  “The concept of daily bread,” he wrote, “born from the experience of deprivation under the conditions of uncertain and insufficient material production, cannot simply be translated into the world of bread factories and surplus production.”
     …  Habermas remains an ardent champion of reason’s democratic possibilities
     …  the millennia-long dialogue between reason and faith, a “learning process”
     …  little in our current situation can warrant the prediction that religion will vanish any time soon
     …  the demand for an ongoing dialogue between religion and reason has become a political imperative, though we can hardly miss the final irony that such a dialogue can only proceed within the framework of a secular state. /21-01-04

    Brain, Gut and Consciousness
     …  the current trend in philosophy of mind is to focus on the role of the brain .. there are also other actors
     …  holobiont
     …  brain-gut-microbiome axis
     …  our consciousness is our emergent property caused by the brain-gut-microbiome axis
     …  our bodies contain on average 3.8x1013 bacteria (10-times more than the number of human nucleated cells) making approximately 0.2 kg
     …  all animals and plants are holobionts
     …  we have to redefine the concept of an individual
     …  the gut microbiome shapes our emotional states
     …  Scientists hypothesize that the answer to how the slime mold can react in an intelligent way is thanks to its plasmodial cytoskeleton which ‘may have similar functions to those of the mammalian neural network
     …  wood-wide web
     …  panpsychism
     …  even species without the brain as we know it can possibly have consciousness /21-01-04

    infinity
    The ontological decision concerning infinity can then simply be phrased as: an infinite natural multiplicity exists.
    Alain Badiou Being and Event /21-01-03

    2020

    prof. Chan Hong-Mo do prof. Andrzeja Białasa
     …  we must put the Chinese case in its historical context
     …  abject poverty was the rule
     …  China could not produce a bicycle. But now
     …  compares well with the US .. in its reponse to the Covid19
     …  Pride
     …  You will not need much indoctrination .. to be thankful .. the 800 million lifted out of poverty by this ”communist” experiment
     …  Trump and most of the English-speaking West are whipping up instead Sinophobia
     …  I am not saying that China should or will lead the world
     …  China’s faults are plain to see. .. Uighur .. Hong Kong
     …  Tibet, reported in a western newspaper accompanied by a picture of protestors .. but it turned out that the picture was taken in Delhi
     …  It was Chinese scientists who first described .. on 24 January this year
     …  in the last 6 months, while the nation suffered .. billionaires in the US gain collectively in wealth by nearly a trillion dollars
     …  We do not know the full answer to the question what is wrong in present democratic systems or what is to be done to correct it, but we must find the answer soon to save human society, as we know it, from becoming a relic like the Egyptian pyramid.
     …  Sorry Andrzej, to end with such a sombre note /20-12-24

    Richard Dawkins attacks on scientific truth
     …  Scientists too can make mistakes
     …  attack on truth itself .. the very existence of truth
     …  Orwell’s .. two plus two equals five if the Party decrees it so .. Donald Trump
     …  A more insidious threat to truth comes from certain schools of academic philosophy. There is no objective truth, they say, no natural reality, only social constructs.
     …  You can’t not ‘believe in DNA’. DNA is a fact.
     …  A mathematical proof reveals a definite truth, no matter whether the mathematician ‘identifies as’ female, male or hippopotamus.
     …  Those philosophers of science who fixate on the case of Newton and Einstein love to say that scientific truths are only ever provisional approximations that have so far resisted falsification.
     …  There’s no law that says truths about nature have to be comprehensible by the human brain.
     …  We have to live with the limitations of a brain that was built by Darwinian natural selection of hunter-gatherer ancestors on the African savanna, where medium-sized things like antelopes and potential mates moved at medium speeds.
     …  ‘mystery of the Trinity’ (how can God be both three and one at the same time?)
     …  Quantum theory is mysterious .. What’s the difference?
     …  The double blind control test
     …  I treasure the remark of a homeopathic doctor who, when his methods failed under double blind testing conditions, said: ‘You see. This is why we don’t do double blind tests any more. They never work!’
     …  we also know what we don’t know
     …  science can properly claim to be the gold standard of truth /20-12-21

    dead civilizations The Milky Way is probably full of .. three Caltech physicists
     …  modern astronomy and statistical modeling to map the emergence and death of intelligent life
     …  equation .. Frank Drake .. 1961
     …  intelligent creatures' tendency toward self-annihilation
     …  the probability of and time necessary for intelligent life to evolve
     …  13,000 light-years from the galactic center and 8 billion years after the galaxy formed .. Earth .. 25,000 .. 13.5
     …  Most of these other civilizations that still exist in the galaxy today are likely young, due to the probability that intelligent life is fairly likely to eradicate itself over long timescales. /20-12-21

    Chance in Shaping Life and Evolution
     …  A Series of Fortunate Events, Sean B. Carroll
     …  the profound impact of randomness in determining destiny
     …  Hamlet .. probability in William Shakespeare’s tragedy
     …  Jacques Monod .. Pure chance, absolutely free and blind .. There is no scientific concept .. more destructive of anthropocentrism than this one.
     …  Man was the product of an incalculable number of fortuitous events.
     …  For those who still believed that God was in charge, micromanaging the events of the universe
     …  The mere existence of chance is enough to rip God from his cosmic throne.
     …  If we accept that chance plays any role at all, it leaves God not only out of date, but out of a job.
     …  genetic mutations are just one kind of random happening .. Take asteroids
     …  “Look around you at all the beauty, complexity, and variety of life. We live in a world of mistakes, governed by chance”
     …  imaginary conversation between Monod, Albert Camus, Kurt Vonnegut
     …  "We’re not special, we’re just lucky" /20-12-14

    Gaia hypothesis states that our biosphere is evolving
     …  scientists included, harbour contradictory intuitions about Mother Nature
     …  species have evolved to cooperate with one another .. nonsense: organisms are ‘selfish’ .. a brutish Darwinian competition
     …  The idea that the Earth itself is like a single evolving ‘organism’ .. mid-1970s .. James Lovelock
     …  system able to maintain the Earth in homeostasis
     …  New Age enthusiasts .. rough treatment at the hands of evolutionary biologists
     …  Darwinian natural selection doesn’t work that way.
     …  have had a point .. to ‘Darwinise Gaia’ – to see widespread cooperation as a result of competition occurring at some higher (even planetary) level
     …  a way to reflect on contemporary environmental crises
     …  heritable variation .. differential reproduction.
     …  Richard Dawkins’s The Selfish Gene .. a hardcore gene-centrism
     …  to qualify as a thing on which natural selection can operate – a unit of selection – ‘they must be connected by parent-offspring relations
     …  Without reproduction, fitness is undefined
     …  Maybe algal mats do control global temperature and coral reefs do have a beneficial effect on ocean salinity, but this is just good luck.
     …  whereby successful planets spawned copies of their life forms on new planets
     …  anthropic principle
     …  differential persistence – mere survival – as a legitimate form or mechanism of natural selection .. radioactive atoms .. if there were any ‘mutations’ that gave atoms the ability to resist decay, then those left intact after several half-lives would be more likely to possess such mutations .. like a sort of natural selection
     …  something resembling Darwinian thinking
     …  Gaia is just the single clade of all living things descended from life’s last universal common ancestor
     …  clades cannot reproduce: they can only persist
     …  LUCA
     …  had evolved some sort of species-to-species within-clade cooperation … 
    replicator: an entity that passes on its structure directly in replication.
    interactor: an entity that directly interacts as a cohesive whole with its environment in such a way that replication is differential …
    selection: a process in which the differential extinction and proliferation of interactors cause the differential perpetuation of the replicators that produced them.
     …  holobionts, multispecies entities that interact as ‘cohesive wholes’
     …  ‘It’s the song, not the singers’ (ITSNTS) .. Meme theory
     …  because there are singers, there’s a song .. because there’s a song, there are singers
     …  Songs don’t themselves reproduce, but they are re-produced and do evolve.
     …  David Haig .. Material genes were physical objects but informational genes were the abstract sequences of which material genes were temporary vehicles. Material genes were identified with gene tokens and informational genes with gene types .. Continuity resides in the recursive representation of immortal pattern by ephemeral avatars
     …  immateriality/materiality problem
     …  Darwinising Gaia .. to look at nature as a coherent whole /20-12-10

    The Universe Speaks in Numbers by Graham Farmelo, Conclusion
    • Space and time are not fundamental concepts—they emerge from quanta of some kind. If this is correct, it would refute Einstein’s conviction that quantum mechanics is a much less well-grounded theory than relativity.
    • Supersymmetry will, sooner or later, be demonstrated experimentally to be a fundamental feature of the laws of nature. Such a discovery would help to justify the faith of many theoreticians that beautiful mathematics serves as a useful lodestar.
    • Magnetic monopoles, branes, and other subnuclear exotica are no less real than the electrons and quarks that make up ordinary matter.
    • The origins of the dualities in modern physics—that is, the pairs of theories that look mathematically different but give identical descriptions of the world—will be understood.
    • Maldacena duality—the idea that a string theory of gravity can be exactly equivalent to a corresponding gauge theory—will prove to be relevant to the real world.
    • Quantum field theory, which describes the behaviour of subatomic particles, will be set out in a much simpler way. One consequence will be that calculations using the theory will be greatly simplified.  …  Regardless of who (or what) continues the search for the fundamental laws of nature, I doubt the quest will ever end. .. it is always best to regard laws of physics as provisional and destined to be modified as human experience and knowledge advance. .. physicists have not one but two ways of improving their fundamental understanding of how nature works: by collecting data from experiments and by discovering the mathematics that best describes the underlying order of the cosmos. The universe is whispering its secrets to us, in stereo. /20-12-09

    photonic quantum computer
     …  Jiuzhang after an ancient Chinese mathematical text
     …  perform a calculation in 200 seconds .. more than half a billion years on the world’s fastest classical computer
     …  boson sampling .. beam splitters .. quantum superposition
     …  Paths also merge together .. photons to interfere with one another
     …  photons in each of the network’s output channels is measured
     …  repeated many times
     …  76 photons traversed a network of 100 channels
     …  the calculations are esoteric ones designed to be difficult for classical computers
     …  only a single type of task, namely, boson sampling. In contrast, Google’s quantum computer could be programmed to execute a variety of algorithms /20-12-04

    Pojecia metafizyczne są szyframi Boga - Karol Tarnowski, Seminarium, czytanie Mariona "Idol i dystans" /20-12-03

    Can a Computer Devise a Theory of Everything? It might be possible, physicists say, but not anytime soon. And there’s no guarantee that we humans will understand the result.
     …  translating languages, recognizing faces, driving cars, recommending whom to date
     …  carbon chauvinism
     …  M.I.T. .. Institute for Artificial Intelligence and Fundamental Interactions
     …  Rediscovering the fundamental laws
     …  100 physics equations from a famous textbook — “The Feynman Lectures on Physics”
     …  Could it produce a theory that we humans can’t understand?
     …  romantic overstatements about the power and threat of superintelligent machines /20-11-30

    Obrazy świata Copernicus College, Marek Kuś
     …  związkom między naukami ścisłymi i przyrodniczymi z jednej strony i naukami humanistycznymi i społecznymi z drugiej
     …  Klasyfikacja nauk .. Przypadkowość .. Prawdopodobieństwo .. Emergencja i redukcja .. Przyczynowość .. Prawa natury .. Wyjaśnianie naukowe .. Matematyka i inne działy nauk .. Przenoszenie metod między obszarami nauki .. Analogie i metafory w naukach ścisłych .. Dwie kultury /20-11-27

    A.I.-Created Fake People
     …  for $2.99, or 1,000 people for $1,000
     …  ThisPersonDoesNotExist.com
     …  These simulated people are starting to show up around the internet, used as masks by real people with nefarious intent: spies who don an attractive face in an effort to infiltrate the intelligence community; right-wing propagandists who hide behind fake profiles, photo and all; online harassers who troll their targets with a friendly visage.
     …  generative adversarial network
     …  GAN software .. Nvidia
     …  identifying key facial features
     …  recognizing a stranger from just one photo
     …  Humans choose how A.I. systems are made and what data they are exposed to.
     …  assuming we are so smart that we can create things smarter still? /20-11-22

    Life with purpose Biologists balk at any talk of ‘goals’ or ‘intentions’
     …  an absurdly anthropomorphic way
     …  experiment from 1944, which revealed the human impulse to attribute goals and narratives to what we see
     …  we can’t meaningfully describe what a macrophage even is without referring to its purpose
     …  organisms don’t evolve ‘in order to’ achieve anything
     …  we now have growing reasons to suspect that agency is a genuine natural phenomenon
     …  and, moreover, that it’s not necessarily unique to living organisms
     …  A bottom-up theory of agency could help us interpret what we see in life .. our ‘smart’ machines and technologies .. We’re starting to wonder whether artificial intelligence systems might themselves develop agency. But how would we know, if we can’t say what agency entails?
     …  Goal-directed actions seem almost axiomatically biological .. just a figure of speech .. programmed via natural selection
     …  all living entities as ‘machines’ built by genes, as Richard Dawkins called them
     …  genes don’t fully specify behavioural outcomes .. Genes can imbue dispositions or tendencies .. If all behaviour were hardwired, individual organisms could never find creative solutions to novel problems
     …  a crucial dimension of agency: the ability to make choices in response to new and unforeseen circumstances. When a hare is being pursued by a wolf, there’s no meaningful way to predict .. Both hare and wolf are exercising their agency.
     …  the common assumption that complex agential behaviour requires a concomitantly complex mind.
     …  Some things that plants do – such as apparently selecting a direction of growth based on past experience – can look like purposeful and even ‘mindful’ action, especially as they can involve electrical signals reminiscent of those produced by neurons.
     …  Agency stems from two ingredients: first, an ability to produce different responses to identical (or equivalent) stimuli, and second, to select between them in a goal-directed way. Neither of these capacities is unique to humans, nor to brains in general.
     …  mere behavioural randomness .. Fruit flies show some random variation in their turning movements
     …  you don’t even need so much as a nervous system to get random
     …  ‘free’ choice is typically effortful, involving the conscious contemplation of imagined future scenarios based on past experience
     …  the physics of information .. the second law of thermodynamics .. Maxwell’s demon
     …  The demon .. having access to microscopic information .. never hope to perceive
     …  The demon then becomes an ‘information engine’ .. This missing link could release biology from having to pretend that agency is just a convenient fiction
     …  Landauer’s analysis .. the capacity to store information about the environment – is a kind of fuel that must be constantly replenished.
     …  the characteristic of living organisms .. 1940 .. Erwin Schrödinger: it creates and sustains order in the face of the tendency of the second law to erode it.
     …  the agent has a goal but no prescribed route to attaining it
     …  ‘What is needed to fully understand biological agency,’ say the complex-systems theorist Stuart Kauffman and the philosopher Philip Clayton, ‘has not yet been formulated: an adequate theory of organisation.’
     …  intersection of information theory, thermodynamics and life
     …  it’s vital for a goal-directed entity such as a cell, an animal or even a tiny demon to have a memory
     …  Energy efficiency .. evolutionary biology
     …  how can your goal be best achieved – how can you maximise your agency – when you’re not so all-seeing? That’s where the value of prediction and anticipation comes in.
     …  partial knowledge
     …  efficiency .. to focus only on information that’s useful
     …  the agent changes the process to be learned about .. the choice of adapting to circumstances or acting to alter those circumstances
     …  even ‘minimal agents’ can find inventive strategies, without any real cognition at all
     …  a sort of “impedance match” between certain action sequences and the dynamics of the environment
     …  For humans .. a mixture of deliberation, experience and instinct: heavyweight cogitation
     …  Wissner-Gross and Freer .. ‘entropic force’ .. to work out the entropic consequences – to make their ‘choices’
     …  the agency required to solve apparently complex problems can emerge from a strikingly simple entropic rule
     …  without recourse to mysticism. Evolution creates and reinforces goals – energy-efficiency, say – but doesn’t specify the way to attain them. Rather, an organism selected for efficiency will evolve a memory to store and represent aspects of its environment that are salient to that end. That’s what creates the raw material for agency.
     …  alternative courses of action in response to essentially identical stimuli .. At first, the choice among them might be random. But organisms with memories
     …  complex cognition often seems to have evolved from a mash-up of capabilities that arose for other purposes
     …  agency appears to be an occasional, remarkable property of matter, and one we should feel comfortable invoking when offering causal explanations of what we’re observing
     …  ‘Agents are causes of things in the Universe,’ says the neuroscientist Kevin Mitchell
     …  Agency is one of the classic examples of an emergent property
     …  A genuine theory of agency might finally help to clarify what science can say about free will /20-11-22

    Gömböc /20-11-21

    Conspiracy theories Yuval Noah Harari
     …  global cabal theory
     …  26,000 people in 25 countries asked respondents whether they believe there is “a single group of people who secretly control events and rule the world together.” 37% of Americans replied that this is “definitely or probably true.” 45% of Italians, 55% of Spaniards and 78% of Nigerians
     …  Nazism, for example
     …  Freemasons .. Satanists .. aliens .. reptilian lizard people
     …  a single, straightforward explanation
     …  basic flaw: They assume that history is very simple .. that it is relatively easy to manipulate the world. A small group of people can understand, predict and control everything
     …  There are, of course, many real conspiracies in the world. .. corporations .. churches
     …  Realizing that no single cabal can secretly control the entire world .. you can identify the competing factions in our world, and ally yourself with some groups against others. That’s what real politics is all about. /20-11-21

    a vast assembly of nerve cells Francis Crick
     …  The belief that we can explain how the brain produces consciousness .. to solve the “hard problem”
     …  can’t be solved because it doesn’t exist
     …  between the body and the mind, the self and the other, or the nameable and the unnameable
     …  Three New Books Explore the Machinery of the Mind /20-11-21

    Albert Einstein The theory of gravitation [converted me] into a believing rationalist, that is, into someone who seeks the only trustworthy source of truth in mathematical simplicity.
    1938, letter to Cornelius Lanczos, wg The Universe Speaks in Numbers: How Modern Math Reveals Nature's Deepest Secrets by Graham Farmelo /20-11-20

    Karol Tarnowski w rozmowie z Marią Karolczach, w ramach Dni Tischnerowskich>, że na wycieczce, Karol Wojtyła powiedział do niego:
    "Wiesz, wszystko jest dobre" /20-11-19

    Adam Zagajewski, Jarosław Gugała /20-11-14

    sunlight-activated catalysts photocatalysts
     …  break the resistant double bond between carbon and oxygen in carbon dioxide
     …  solar refineries
     …  Photocatalysts are typically semiconductors, which require high-energy ultraviolet light to generate the electrons involved in the transformation of carbon dioxide.
     …  ultraviolet .. 5 percent of sunlight
     …  to be commercialized
     …  negative emissions a reality /20-11-12

    Zaklęcie   Robert Pinsky Reads “Incantation” By Czesław Milosz /20-11-12
    Pięk­ny jest ludz­ki ro­zum i nie­zwy­cię­żo­ny.
    Ani kra­ta, ni drut, ni od­da­nie ksią­żek na prze­miał,
    Ani wy­rok ba­ni­cji nie mogą nic prze­ciw nie­mu.
    On usta­na­wia w ję­zy­ku po­wszech­ne idee
    I pro­wa­dzi nam rękę, więc pi­sze­my z wiel­kiej li­te­ry
    Praw­da i Spra­wie­dli­wość, a z ma­łej kłam­stwo i krzyw­da.
    On po­nad to, co jest, wy­no­si, co być po­win­no,
    Nie­przy­ja­ciel roz­pa­czy, przy­ja­ciel na­dziei.
    On nie zna Żyda ni Gre­ka, nie­wol­ni­ka ni pana,
    W za­rząd od­da­jąc nam wspól­ne go­spo­dar­stwo świa­ta.
    On z plu­ga­we­go zgieł­ku drę­czo­nych wy­ra­zów
    Oca­la zda­nia su­ro­we i ja­sne.
    On mówi nam, że wszyst­ko jest cią­gle nowe pod słoń­cem,
    Otwie­ra dłoń za­krze­płą tego, co już było
    Pięk­na i bar­dzo mło­da jest Filo-So­fi­ja

    I sprzy­mie­rzo­na z nią po­ezja w służ­bie Do­bre­go.
    Na­tu­ra le­d­wo wczo­raj świę­ci­ła ich na­ro­dzi­ny,
    Wieść o tym gó­rom przy­nio­sły jed­no­ro­żec i echo.
    Sław­na bę­dzie ich przy­jaźń, ich czas nie ma gra­nic.
    Ich wro­go­wie wy­da­li sie­bie na znisz­cze­nie.

    AI has cracked
     …  Partial differential equations .. Navier-Stokes
     …  neural networks are fundamentally function approximators
     …  in Euclidean space
     …  in Fourier space /20-11-04

    unreality breaking the link between politics and objective truth
     …  Tsarist Russia was ruled by a class oblivious to existential threats within its own society. An atmosphere of unreality surrounded the rise of Nazism in Germany
     …  the decoupling of American culture from the objective world
     …  Russia’s almost unbroken history of authoritarian and totalitarian rule .. It was not Russian history that informed Fukuyama’s storyline, but a highly idealised reading of American history projected throughout the world.
     …  White House .. “We are an empire now and when we act, we create our own reality.”
     …  America’s immersion in self-invented worlds contrasts starkly with Russian practice. Like the US, Russia conceals awkward facts behind a media-created veil. Unlike those in the US, Russia’s ruling elites know this virtual world is deceptive.
     …  Jeremy Bentham (1748-1832) .. utilitarianism. The idea of fictional worlds has been around for much longer than the technologies that now daily create them.
     …  Marshall McLuhan’s Understanding Media: The Extensions of Man (1964) .. “the medium is the message”
     …  a fiction is not an illusion but a tool for shaping the perceptions of others
     …  Are virtual worlds deliberately manufactured, or do they emerge – like myths in past times – from the depths of a common form of life?
     …  For the Bolsheviks Soviet communism was an avowedly westernising project, a combination of French Jacobinism with American Taylorism – the ideology of “scientific labour management” which Lenin admired and Trotsky tried to implement.
     …  (AW:") Hapsburg empire (")
     …  China is building a future imported from the Western past
     …  Enlightenment project; although not the liberal project of John Locke or John Stuart Mill, or the communist utopia of Marx, to be sure. Xi’s dictatorship is more like the enlightened despotism of the early Bentham, who aimed to reconstruct society on the model of a Panopticon – an ideal prison designed to enable total surveillance of the inmates.
     …  How curious ... a hyper- authoritarian China emerges as the only major state still governed by an Enlightenment faith in progress.
     …  the EU’s hallucinatory self-image as a developing super-state square with the fact that Germany – its leading power – has a growing dependency on Russia for a crucial part of its energy supply?
     …  increasingly unstable biosphere
     …  shifts in human consciousness
     …  America is drifting away from what used to be called Western civilisation
     …  History Has Begun: The Birth of a New America Bruno Macaes /20-11-04

    What is life? Paul Nurse
     …  The cell is .. biology’s atom.
     …  each cell is itself a living entity
     …  Cell division .. is fundamental to all life.
     …  Genes are the basic units of inheritance.
     …  Mendel .. DNA ..
     …  cell division is preceded by a doubling the number of chromosomes .. germ cells .. takes place without this preliminary doubling .. one copy from each of its parents
     …  four-letter alphabet .. The DNA copying process is extremely accurate, but not perfect .. mutations
     …  Evolution by natural selection .. Darwin .. competition .. the survival of the fittest .. drama of evolution, leading to the enormous diversity of life
     …  sexual production .. the endless shuffling of genes
     …  transfer of genes between different species, for which viruses can act as vectors
     …  common ancestry
     …  life as chemistry .. fermentation .. ATP as energy store
     …  life as information
     …  seeking food and a mate, and avoiding threats
     …  We have developed antibiotics .. we are breeding resistant bacteria
     …  in future the rich and powerful will have the most opportunity to manipulate the development of their offspring
     …  all selective breeding of plants or animals is genetic modification
     …  synthetic biology
     …  atmospheric carbon dioxide by converting it to biofuels
     …  what is life? .. unsatisfactory schoolroom definition, ”movement, respiration, sensitivity, growth, reproduction, excretion, and nutrition”
     …  Life is based on chemistry, and central to life on Earth is the chemistry of the information-storing molecule, DNA.
     …  the element carbon, capable of incorporation into complex molecules that are stable, but not too stable
     …  all complex organisms depend on the functioning of other kinds of organism in their ecosystems
     …  eukaryotic cells trace their origins to the ultimate in cooperation, a complete merger between two very different single-celled lifeforms, bacteria and archaea
     …  DNA .. ATP .. clearly indicates a single common origin. But that origin is still unknown. Any solution must resolve a fundamental paradox. Life requires three kinds of component. It requires information storage (accomplished using DNA), working machinery (mainly protein, and built according to specification contained in that DNA), and a boundary between organism and environment, so it is difficult to see how any of these could have come into being unless the others were already in operation.
     …  One attempted resolution of the paradox appeals to the concept of an RNA .. easier to synthesise .. more flexible
     …  the gulf between living and non-living was first bridged by complex minerals such as clays /20-11-04

    existential crisis for higher education .. humanities to survive?
     …  liberal arts colleges are shutting down
     …  shrinking enrollments in English, history and philosophy departments, but also by the rise within those departments of conceptions of humanistic education that privilege scientistic knowledge accumulation, political activism and the cultivation of “analytical skills” thought to be prized in Silicon Valley
     …  why and how the humanities continue to matter to those outside campus walls
     …  matched the inherent elitism of humanistic inquiry with the democratic faith in everyday intellect /20-10-26

    Evolutionary Psychology: Predictively Powerful
     …  anger evolved as a bargaining tactic to convince other people to treat you better .. The Contexts that Trigger Anger .. experiments conducted across six cultures demonstrate that these precise circumstances trigger the greatest anger in victims.
     …  people’s disgust will be more strongly triggered by objects that pose a greater risk of infection
     …  Error Management Theory .. Type I error (a false positive) or a Type II error (a false negative) .. built to be biased toward the less costly error .. when people look down at the ground from a high vantage point such as a steep hill, they will systematically overperceive their distance to the ground
     …  For example, we could have discussed how evolutionary thinking leads to new predictions about pride, shame, hunger, gratitude, jealousy, political preferences in leaders, universality in mate preferences, cultural differences in mating strategies, reputation, punitive sentiment toward criminals, volunteering for charity, support for economic redistribution, moralizing people who opt out of public goods, the “erasure” of race, our ability to solve mathematical problems that are framed in terms of frequency versus probability, what kinds of conditions improve our statistical inferences, our ability to detect violators of social contracts, whom newborn babies are said to resemble, what psychological features might accompany illness, and theoretically predicted cultural variation in the extent to which people value physical attractiveness—to name a few.
     …  evolutionary approaches lead to an impressive number of new discoveries about the human mind /20-10-24

    Biology’s next great horizon is to understand cells, tissues and organisms as agents with agendas (even if unthinking ones)
     …  Biologists .. scientific behaviourists, explaining and predicting the ways that proteins, organelles, cells, plants, animals and whole biota behave under various conditions
     …  causal mechanisms
     …  any discredited teleology or imputation of reasons and purposes or understanding to the cells
     …  brains are physical minds – not mysterious dualistic minds – processing information
     …  Genes weren’t really selfish, antibodies weren’t really seeking
     …  little biological mechanisms weren’t really agents with agendas, even though thinking of them as if they were often led to insights
     …  ‘You think we shouldn’t anthropomorphise people?’
     …  teleophobia
     …  only metaphorical ‘as if’ goals
     …  naive binary distinction for a continuum of how much agency any system has
     …  Evolution by natural selection has done – and is still doing – all that refining and focusing and differentiating work. We’re all just physical mechanisms made of physical mechanisms obeying the laws of physics and chemistry. But there is a profound difference between the ingenious mechanisms designed by human intelligent designers – clocks and motors and computers, for instance – and the mechanisms designed and assembled by natural selection.
     …  We are still pretty poor at controlling anatomical structure .. this is why we don’t have a real regenerative medicine yet
     …  genomic editing approaches won’t have a clue what genes to edit
     …  representing anatomical target .. when one takes seriously that the collective has an information-processing, not just mechanical, level of analysis
     …  David Marr Vision (1982)
     …  cells .. are born, they apparently take care of their own further development
     …  Detectors and signals and feedback loops .. But there is a difference .. individual cells are not just building blocks .. they have extra competences that turn them into (unthinking) agents that, thanks to information they have on board .. large-scale projects that they needn’t understand
     …  Agents, in this carefully limited perspective, need not be conscious, need not understand, need not have minds, but they do need to be structured to exploit physical regularities that enable them to use information
     …  the cone cell’s knowledge is myopic in the extreme. Its Umwelt is microscopic. It’s an idiot savant
     …  Dennett’s book Darwin’s Dangerous Idea (1995)
     …  an inversion of this familiar idea; the point is not to anthropomorphise morphogenesis – the point is to naturalise cognition.
     …  real cognition is what brains do, and what happens in biochemistry only seems like it’s doing similar things. We propose an inversion of this familiar idea/bold by AW; the point is not to anthropomorphise morphogenesis – the point is to naturalise cognition.
     …  Tissues, organs, brains, animals and swarms form various kinds of minds that can reach for bigger goals
     …  there is little fundamental difference between neurons and other cell types
     …  The central point about cognitive systems .. (.. animals, cells .. AI .. alien life) is what they know how to detect, represent as memories, anticipate, decide among and – crucially – attempt to affect.
     …  It’s all about goals
     …  belonging to a larger, unified self
     …  the tiny cognitive contribution of a single cell to the cognitive projects and talents of a lone human .. tribe
     …  the whole cosmos and even the abstract spaces of mathematics, poetry and music
     …  Instead of treating human ‘genius’ as a sort of black box made of magical smartstuff, we can reinterpret it as an explosive expansion of the bag of mechanical-but-cognitive tricks discovered by natural selection over billions of years. /20-10-15

    Proteins CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC these forty letters are a set of instructions for building a sophisticated medical device .. smaller than the virus on which it operates
     …  Proteins .. do most of the work of life. Antibodies .. are proteins. So are hormones .. enzymes
     …  A protein is a large molecule built from smaller molecules called amino acids. Our bodies use twenty amino acids to create proteins; our cells chain them together, following instructions in our DNA.
     …  CI.. cysteine and isoleucine
     …  Designer proteins .. cure diseases .. new kinds of materials and electronics .. create and transform life itself
     …  Protein design is hard for lots of reasons. Evolution has had billions of years to explore, by trial and error
     …  Nature .. using the ultimate parallel-processing computer: the universe.
     …  RosettaCommons .. “sampling method” and an “energy function”
     …  a system of directed evolution
     …  developing A.I. to do the selecting
     …  trying to change the way that technology and engineering on the molecular scale are done in biology /20-09-25

    /20-09-25

    Noam Chomsky
     …  concern for the COVID-19 crisis is virtually all-consuming. That’s understandable. It is severe and is severely disrupting lives. But it will pass, though at horrendous cost, and there will be recovery. There will not be recovery from the melting of the arctic ice sheets and the other consequences of global warming.
     …  Trump and his courtiers take pride in leading the race to destruction
     …  people who breathed dirtier air were about twice as likely to die from the infection
     …  Dismantling capitalism is impossible in the time frame that we have for taking urgent action
     …  The Green New Deal is the only approach to climate stabilization also capable of reversing rising inequality and defeating global neoliberalism and ascendant neofascism
     …  the old is dying and the new cannot be born; in this interregnum, a great variety of morbid symptoms appear /20-09-20

    Popularyzacja nauki PAUza Akademicka nr. 523
     …  większość publicystów .. ma nikłe pojęcie o tym, co to jest metoda naukowa badania rzeczywistości
     …  Scientia PAUperum
     …  jakie są tutaj dopuszczalne granice uproszczeń .. w którym momencie stają się szkodliwe
     …  1933, Stanisław Loria, fizyk .. Bardzo szkodliwe jest mniemanie, że do napisania artykułu lub książki popularnonaukowej niepotrzebna jest gruntowna wiedza fachowa, lecz wystarczy dość powierzchowna znajomość przedmiotu .. O wiele łatwiej jest napisać dobry referat naukowy, przeznaczony dla uczonych, aniżeli dobry artykuł lub wykład popularny dla laików. .. Krzykliwe tytuły, jaskrawe przeciwstawienia, reklamiarska przesada, facecje i kpiarstwo .. do uśpienia czujności lękliwego czytelnika, który by w panicznym strachu uciekł przed nudą wykładu .. Nie wierzę jednak w skuteczność i celowość takiej „popularyzacji” /20-09-18

    capitalism isn't working. Here's an alternative
     …  future transformed by Covid-19
     …  democratic socialism
     …  Margaret Thatcher .. There is no alternative
     …  when the Soviet Union collapsed in 1991 .. social democrats, Keynesians and Marxists alike .. in 2008, with Lehman’s collapse
     …  how democratic socialism could work today, with our current technologies and despite our human failings
     …  precisely how would things – like money, companies and housing – work?
     …  Another Now .. a Marxist-feminist, a libertarian ex-banker and a maverick technologist
     …  central banks provide every adult with a free bank account into which a fixed stipend (called universal basic dividend) is credited monthly
     …  People receive two types of income: the dividends credited into their central bank account and earnings from working in a corpo-syndicalist company. Neither are taxed
     …  All trade and all money movements between different monetary jurisdictions (eg the UK and the eurozone or the US) are denominated in a new digital accounting unit, called the Kosmos. /20-09-17

    brains have evolved to the point where we can build artificial brains that might help us understand our brains
     …  novel insights and deep analyses enabled by smart instruments and machine learning
     …  revolutionized workflows
     …  DNA .. researchers have not yet succeeded in demonstrating a route from raw chemical materials to those crucial macromolecules
     …  a sort of self-motivation to replicate .. the dawn of intelligence
     …  self-driving microscopes
     …  can conceive of, build, and manipulate models of itself
     …  The master is becoming the student. /20-09-17

    AI tools are shaping next-generation theorem provers, and with them the relationship between math and machine.
     …  Cohen .. all of mathematics could be automated
     …  crazy contact between an imaginary, nonphysical world and biologically evolved creatures .. We did not evolve to do this
     …  proofs generally follow deductive, step-by-step logic. They often require complicated creative thinking
     …  the possibility of automating reason itself
     …  2016 .. a computer program to prove .. the Boolean Pythagorean triples problem .. 200 terabytes
     …  Computers have done amazing calculations for us, but they have never solved a hard problem on their own
     …  computer proofs may not be as alien as we think
     …  teaching tools .. It forces you to be very organized and think clearly
     …  By the time I’ve reframed my question into a form that could fit into this technology, I would have solved the problem myself.
     …  theorem provers replace human referees at major journals
     …  the communication barrier between the language of humans and the language of computers
     …  What an ATP doesn’t do is explain its work .. it’s impossible to scan the proof and follow the reasoning, because it looks like a pile of random data.
     …  new conjectures generated by a neural network trained on theorem-proving data
     …  Neural networks are able to develop an artificial style of intuition
     …  computers will be able to out-reason mathematicians by 2099
     …  Even if computers understand, they don’t understand in a human way /20-09-11

    Naiwność jako jakość estetycznie doniosła Roman Ingarden /20-09-02

    Probability The New Yorker
     …  In a group of just twenty-three people, there’s a fifty per cent chance that two of them share a birthday
     …  one of three doors to win a prize. The Monty Hall problem
     …  It should be a fifty-fifty shot, but it always takes me at least six tries to insert a USB dongle into my mouth.
     …  There are 8.06e + 67 different ways to shuffle a deck of cards. Most people can’t wrap their head around the magnitude of this number. It helps if you think of something pretty big, like a horse, or one of those larger-sized microwaves. /20-09-02

    against Handshakes Should Become Permanent
     …  because of COVID-19, the handshake is out
     …  the custom of shaking hands originated in the ancient and universal practice of grasping the weapon hand during a truce as a precaution against treachery
     …  the Hindu palms-together and head bow; the Islamic hand on the heart; the military salute /20-08-17

    Bertrand Russell idleness
     …  Human beings are more than just workers. We need to learn how to value idleness.
     …  universal basic income
     …  1930 .. John Maynard Keynes predicted that, within a century .. working 15 hours a week
     …  A first step lies in education. Schools and universities are not only valuable because they prepare us for work, but also because they prepare us for leisure.
     …  who reads about physics or philosophy for fun
     …  a central goal of education was to equip the population with the necessary abilities, knowledge and habits to enjoy creative leisure /20-08-14

    Noam Chomsky vote for Joe Biden
     …  91 years old
     …  DiEM25
     …  Biden .. Farther to the left than any Democratic candidate in memory on things like climate. It's far better than anything that preceded it
     …  You vote against the worst.
     …  Sanders
     …  the message at Davos was: Yes, we realize we've done wrong things during this whole neoliberal period.
     …  Alexandria Ocasio-Cortez
     …  Green New Deal
     …  The United States is an extreme, business-run society with a very rigid set of controls. So words like socialist are scare words. Means the gulag. Communist, you can't even mention.
     …  to read The New York Times in the morning than to look at what filters its way down to Facebook /20-08-14

    fooling themselves over statistics
     …  simulated data can reveal common ways in which our cognitive biases mislead us
     …  robust, credible research
     …  changing incentives
     …  All-too-human cognitive biases can lead us to see results that aren’t there.
     …  Just as lab scientists are not allowed to handle dangerous substances without safety training, researchers should not be allowed anywhere near a P value or similar measure of statistical probability until they have demonstrated that they understand what it means.
     …  We all tend to overlook evidence that contradicts our views. .. It can be adaptive: humans need to be able to separate out important information and act quickly to get out of danger. But this filtering can lead to scientific error.
     …  Millikan’s 1913 .. he claimed that his paper included all data points .. his notebooks revealed other
     …  people have trouble grasping the uncertainty inherent in small samples
     …  if you test 14 metabolites .. then your probability of finding at least one P value below 0.05 .. by chance is not 1 in 20, but closer to 1 in 2.
     …  One thing is clear: conventional training in statistics is insufficient, or even counterproductive, because it might give the user misplaced confidence .. an alternative approach: generating simulated data that students can subject to various kinds of statistical analysis. /20-08-14

    A.I. generated portraits Vincent van Gogh, Napoleon Bonaparte, George Washington, Elizabeth Tudor, Niccolo Machiavelli, Rembrandt Harmenszoon van Rijn, Jezus of Nazareth, Lady Liberty, Mona Lisa
    /20-08-07

    Cyborg By John Horgan
     …  Neuroscientist Christof Koch has suggested that we get brain implants to keep up with machines.
     …  AI inside the brain and peripheral nervous system .. to hook you to the cloud without the intermediary of a keyboard
     …  Neuralink, Facebook and Kernel
     …  privacy safeguards are essential
     …  pressured to use brain implants so that they can stay competitive .. Enhancement should be truly optional
     …  the elite few are enhanced there will be a vast intellectual gulf between the have and have-nots
     …  Are philosophical investigations of consciousness relevant .. Yes
     …  “Human Calculator” will give you savant-level mathematical abilities; “Zen Garden” can give you the meditative states of a Zen master.
     …  to understand whether it is wise to enhance in these radical ways, you must first understand what and who you are.
     …  if you replace too much of your brain with microchips, you will at some point kill yourself!
     …  consciousness .. we don’t fully understand why all the information processing in the brain feels like something
     …  AI, in contrast, wouldn’t have this limit, but they would be incapable of consciousness. But they may still outthink us, and if they did, this would mean the most intelligent entities on Earth wouldn’t even be conscious.
     …  we would find immortality tedious
     …  Generality is a matter of degree
     …  Perhaps the AI systems of the far future will be more general than we are
     …  If superintelligent AI outthinks us .. “the control problem”
     …  superintelligent extraterrestrials
     …  because Earth is a relatively young planet, there should be many planets with civilizations older than ours
     …  whether radical enhancement is compatible with the continuation of one’s consciousness and selfhood, are germane to discussions about the evolution of intelligent life throughout the universe /20-07-29

    nuclear fusion
     …  The world’s largest .. in southern France
     …  the most complex engineering endeavour in history
     …  200km of superconducting cables, all kept at -269C
     …  Iter .. tokamak
     …  a temperature of 150m C, 10 times hotter than the core of the sun. The hydrogen fuel is obtained from seawater
     …  it is intended to be a proof-of-concept of large-scale fusion, not a design for a future commercial reactor /20-07-29

    The question of the whole Alain Badiou and Jacques Derrida
     …  there is a whole
     …  Cantorian Revolution
     …  the failures of the metaphysics of presence
     …  the experience of the undecidable is the experience of an inconsistent whole
     …  The possibility of transcendental philosophy, a philosophy that would seek to ascertain the limits of thought, has been exhausted. This end, however, constitutes a new beginning. It is the birth of infinite thought.
     …  Being and Event Badiou .. Cantor-Gödel-Cohen-Easton symptom .. Ernst Zermelo
     …  Cantor established that it was possible to think the infinite
     …  Gottlob Frege’s unlimited abstraction principle
     …  overcoming of the metaphysics of presence
     …  Cantor .. reserved the name ‘God’ for this whole in his private writings.
     …  Increasable actual-infinite or transfinite
     …  Unincreasable actual-infinite or Absolute
     …  ‘Absolute’ here is treated as incomprehensible .. the problematic status of overly large ordinals
     …  The Absolute can only be recognized, never known, not even approximately.
     …  ‘Cantor’s thought thus wavers between onto-theology .. and mathematical ontology
     …  road that onto-theologians have traveled for millennia
     …  what if there were a deeper truth here, namely that Cantor could not but assert the existence of the paradoxical, Absolutely Infinite? /20-07-29

    Nikt nie wie, gdzie jest skwer Władysława Bartoszewskiego [AW: w Krk]
     …  Że się urodziłem .. przejście od niebytu do bytu, uważam .. od bytu embrionalnego .. Człowiek sobie nie uświadamia, ale był taki czas, że nas w ogóle nie było .. jak gdyby z nicości .. człowiek pobożny powie, że żył w myśli Bożej, może, ale tego nie pamiętam .. Natomiast jestem świadom, że Świat sobie istniał beze mnie
     …  Ochrzcił mnie ksiądz, który potem został biskupem. Więc też się wspaniale składa
     …  Bardzo chciałbym, żeby tavm się odprawiła msza pogrzebowa .. przełożeni zakonni nie bardzo .. tam się zaczęło i tam się [..] by skończyło, no zobaczymy
     …  Człowiek nie myśli o tym, uważa to za oczywiste, że jest.
     …  7 lat .. dziecko ofiarowywało się Matce Boskiej, Jasnogórskiej. Nie wiem na czym to polegało
     …  85 lat - w Niepołomicach
     …  Datę urodzenia się obchodzą także .. zwierzęta (gdzieś czytałem) .. 25 lipca
     …  Pan doktor onkolog .. powiew, zimny śmierci .. ludzie umierają, to jest nic nowego .. ona przyjdzie, kiedy ma przyjść
     …  Maszerujemy w kierunku wieczności
     …  Rzeczy, które zostały mu w tej chwili, jedyny raz w historii Wszechświata dane.
    Ks. Adam Boniecki w rozmowie z Katarzyną Kubisiowską, Podcast Tygodnika Powszechnego/20-07-21

    at the beginning of life’s history
     …  “Chiral” molecules exist in paired forms that mirror each other
     …  Many researchers believe the selection to be random: Those right-handed genetic strands just happened to pop up first
     …  weak force — the only fundamental force with a known mirror asymmetry. Pions slamming into the atmosphere /20-07-13

    Szapocznikow
     …  It must be said, for it is too easily forgotten, that the sick body still lives.
     …  exceed the mortal body “to exalt the ephemeral in the folds of our body, in the traces of our passage,” as she wished /20-07-13

    Entropy
     …  Thermodynamics was extremely useful science for a society in the throes of rapid industrialization and a shift toward a capitalistic free market.
     …  You never get anything—energy or work—for free.
     …  An illuminating parallel for such social embeddedness can be found in Darwin’s work.
     …  Keynes .. “The principle of the survival of the fittest could be regarded as a vast generalization .."
     …  Darwinian and thermodynamic theories served jointly to furnish a propitious worldview
     …  the age of the Earth .. Darwin .. at least a billion years .. Kelvin .. Between 20 and 400 million years
     …  why organisms age, why societies collapse, and why evolution requires divine intervention
     …  In almost every erroneous overextension of the first and second laws, one word marks the crux of the error. The laws refer to an isolated system.
     …  the fourth law of thermodynamics: There is no such thing as an isolated system.
     …  shaped as it is by popularized versions of Victorian science, leads us dangerously astray
     …  Not in buying a new more efficient car, but in leaving the old one parked. /20-07-10

    Darwin and Nietzsche Selection, Evolution, and Morality / CATHERINE WILSON
     …  his rejection of the major elements of Darwin’s overall scheme on observational grounds
     …  opposition to the attempt of Darwin and many of his followers to reconcile the “struggle for existence” with Christian ethics
     …  Ernst Haeckel .. popularizers of Darwinism .. “immensely rich fruits—fruits which have no equal in the whole history of the civilization of mankind.”
     …  Herbert Spencer, who introduced the phrase “the survival of the fittest” in 1864
     …  Nietzsche’s relationship to Darwinism has been studied repeatedly
     …  is unlikely to have read either Darwin’s The Origin of Species (1859) or his Descent of Man (1871) .. derived from popularizers and synthesizers
     …  “over-all depression of the European spirit” Beyond Good and Evil
     …  “The whole of English Darwinism breathes something like the musty air of English overpopulation, like the smell of the distress and overcrowding of small people” The Gay Science.
     …  antitheological, somatic, future-oriented themes are prominent in Nietzsche’s writings .. deny that those themes are Darwinian
     …  not creatures specially created by God .. humans were the only animals that exhibited intellectual and technological progress
     …  Haeckel .. “ape-like negro tribes”
     …  Eastern religion answered to the need for a non-Christian foundation for morality
     …  Bentham’s utilitarianism
     …  In BGE 62, he laments the ruination of the race through the Christian practices of care for the sick
     …  David Strauss
     …  a gay science to counter the pessimism of the theory of natural selection, a cheerful philosophy of abundance as opposed to one of scarcity
     …  the exceptional man versus the prolific breeding masses
     …  Natural selection, we recognize, is not “for” any purpose .. power to self-replicate and to vary
     …  “The influence of ‘external circumstances,’” says Nietzsche, “is overestimated by Darwin to a ridiculous extent: the essential thing in the life process is precisely the tremendous shaping, form-creating force working from within which utilizes and exploits external circumstances”
     …  The “will to power” is already manifested in the amoeba’s extending its pseudopods .. the will to power can even divide itself into two wills.
     …  “The struggle for existence is only an exception, a temporary restriction of the will to life”
     …  “The isolated individual does not have the good of his species in view: the sexual instinct does not prove this”; it expresses rather a “real achievement of the individual, his highest interest, his highest experience of power” (KSA 12:7 [9]; WP 680).
     …  Nietzsche argues that Darwin’s theory predicts the opposite of what we observe.
     …  Higher types are more complex and more fragile; their disintegration is more likely, so beauty and genius are rarely inherited. The latter point is the critical objection to Darwinism for Nietzsche.
     …  Nietzsche was engaged in a three-cornered argument. In one corner stood the traditional Christians with their commitment to the repression of sensuality as evil and sin, and their supernaturalism. In another corner were the agnostic or atheistic philosophers who wanted to assert, preserve, and even extend Christian values in the face of science, including Kant, Schopenhauer, Darwin, Strauss, and Spencer. In the third corner, there was Nietzsche himself, aesthetically repelled by the masses and their unhealthy propensities, distressed by the suffering of superior individuals, and hostile to traces of asceticism and Orientalism in his contemporaries.
     …  In some respects, then, Nietzsche is a Darwinian.
     …  Like Darwin, he believes that individuals vary in their intrinsic quality: some are superior to others.
     …  He is also much closer to the view of the modern, neo-Darwinian biologist than were the nineteenth-century Darwinians. It is the individual that matters to itself
     …  Nazism was, after all, a regenerationist, postdemocratic, post-Christian social order, where the weak, decrepit and useless were to be legislated out of existence.
     …  Nietzsche .. “When the spirit is rich and independent it most resists any preoccupation with morality”
     …  Joseph De Maistre /20-07-08

    Nietzsche's Anti-Darwinism Dirk R. Johnson
     …  complex connection .. popular opinions have tended to assume a convergence in their thinking
     …  the importance of Darwin for the development of Nietzsche's philosophy, but
     …  an original reinterpretation of the Genealogy of Morals, a text long considered sympathetic to Darwinian naturalism, but which he argues should be taken as Nietzsche's most sophisticated critique of both Darwin and his followers. /20-07-08

    Bonowicz Wojciech w rozmowie on line z Katarzyną Kubisiowską 25 czerwca (Znak).
     …  Izydora Dąmbska … agnostyczka, bardzo zdystansowana do religii … wam to jest łatwiej, macie za sobą 2000 lat tradycji … o najwyższych standardach moralnych niewierzącej osoby … powściągliwie wierzącej … tak powiem ostrożnie /20-06-26

    Something Rather Than Nothing
     …  Big Bang
     …  matter over antimatter?
     …  Maybe, just maybe, neutrinos.
     …  In a perfect universe, we would not exist.
     …  According to the dictates of Einsteinian relativity and the baffling laws of quantum theory, equal numbers of particles and their opposites, antiparticles, should have been created in the Big Bang that set the cosmos in motion.
     …  charge and parity invariance, C and P for short
     …  weak interactions
     …  Nature, in some sense, is left-handed.
     …  Neutrinos .. the most tiny quantity of reality ever imagined by a human being .. 1930
     …  are the most plentiful subatomic particles in the universe
     …  the muon also came with its own associated neutrino
     …  Super-Kamiokande neutrino detector
     …  more neutrino muons going to neutrino electrons than antineutrino muons going to antineutrino electrons
     …  neutrinos violate the CP symmetry /20-06-20

    the universe. Or just annoying background noise
     …  suspicious pings
     …  If the signal is real and persists
     …  a species of subatomic particles called axions .. keeping nature symmetrical
     …  a large impact on our understanding of fundamental physics
     …  other explanations .. a new, unexpected property of .. neutrinos
     …  Yet another equally likely explanation .. contaminated by .. tritium
     …  Or it could all just be a statistical fluctuation .. 5-sigma
     …  Frank Wilczek
     …  Solar axions would not be dark matter /20-06-19

    Efekty kształcenia
     …  Trafny jest termin „kształcenie”, gdy opisuje szkolenie kierowców.
     …  „Franz Brentano wykształcił Edmunda Husserla, Edmund Husserl wykształcił Romana Ingardena, Roman Ingarden wykształcił Józefa Tischnera, a Józef Tischner wykształcił Karola Tarnowskiego...”
     …  Rubryka zatytułowana „efekty kształcenia”, którą władcy nasi każą wypełniać nauczającym, raczej nic z nauczaniem wspólnego nie ma, a pożytek z niej dla władców żaden.
    Paweł Taranczewski/PAUza/20-06-15

    Corvids are large, big-brained birds that often live in intimate social groups of related and unrelated individuals.
     …  They are known to be intelligent—capable of using tools, recognizing human faces, and even understanding physics—and some researchers believe crows may rival apes for smarts.
     …  Humans are characterized by this extended childhood that affects our intelligence, but we can’t be the only ones
     …  corvids spend more time in the nest
     …  Adults were quite tolerant, allowing juveniles to practice and supplementing their food while they learned.
     …  too much credit has been given to humans “as the pinnacle of evolution and intelligence.” /20-06-14

    Universities will never be the same after the coronavirus crisis
     …  The pandemic is speeding up changes in a tremendous way
     …  The Massachusetts Institute of Technology in Cambridge has been putting courses online for free since 2002, but
     …  simply delivering course materials through digital platforms is not the best way to teach students
     …  distributing video lectures early, and focusing in-person time on interacting with students to ensure that they understand the concepts /Nature/20-06-10

    veneer theory, Bregman insists, is totally wrong
     …  Infants and toddlers .. have an innate bias towards fairness and cooperation.
     …  In the first world war, German and British soldiers played football on Christmas Day.
     …  early humans survive while our cousins the Neanderthals did not .. we simply killed them all? .. we humans were better able to cope with the last ice age because we’d developed the ability to work together
     …  the great tragedy of human history was the invention of agriculture and cities around 10,000 years ago. That brought the drudgery of work and the rise of political leaders and war.
     …  Zimbardo’s notorious Stanford prison experiment ably collects the recent discoveries that the whole thing was a hoax /20-06-10

    Władysław Stróżewski o Romanie Ingardenie
    …Spór o istnienie świata, gdzie przedstawił ontologię rzeczywistości możliwej. Natomiast nie znalazł odpowiedniego przejścia do metafizyki, czyli do tego, co stoi za faktycznym istnieniem rzeczywistości. Zasugerował co najwyżej, że taką możliwość daje nawrót do nauk szczegółowych, czyli ścisłych. Zaproponował racjonalne podejście do metafizyki.
    /Roman Ingarden. Filozof i fotograf, MOCAK /20-05-28

    Piękna obecność znaczenia
    Maria Anna Potocka w: Leon Chwistek. Nowe kierunki w sztuce, MOCAK, str. 73
    /20-05-24

    Chwistek jako logik uważał, że każdy nie sprzeczny układ danych wyznacza jakąś rzeczywistość. Dzisiaj można tę myśl sprecyzować, korzystając z twierdzenia Gödla-Malcewa o pełności. Powiada ono, że każdy niesprzeczny zbiór ma model. Jeśli utożsamimy modele z rzeczywistością (lub jej rodzajami), teza Chwistka, że każdy styl malarski związany jest z jakąś rzeczywistością, staje się parafrazą (zwracam uwagę na słowo „parafraza”, które nie znaczy, że mamy do czynienia z konsekwencją logiczną) twierdzenia matematyki.
    Jan Woleński w: Leon Chwistek. Nowe kierunki w sztuce, MOCAK
    /20-05-23

    Roman Ingarden Filozof i fotograf, Maria Anna Potocka, str. 12
    Estetyka Roman Ingardena wychodzi z założenia – dość powszechnego wśród polskich estetyków – że to artyści podążają za filozofią, a nie filozofia za sztuką. Estetyk ustala, czym jest sztuka i czym powinna być. To normatywne podejście nie jest groźne, ponieważ nie jest skuteczne i nie wpływa ani na artystów, ani na historyków sztuki. Natomiast jest ciekawym aktem kreacji. Można w nim znaleźć więcej emocji artystycznych niż właściwości filozoficznych. Stworzony zostaje przepis – wzorzec wartości i piękna. Taka kreatywność – unosząca się ponad dostępną w muzeach rzeczywistością sztuki – szczególnie zaskakuje w kontekście fenomenologii, której Ingarden jest ważnym przedstawicielem. Zaskakujące, że ten filozof wolał widzieć sztukę w sobie niż w tym, co istniało, czyli w twórczości artystów. Takie podejście bardziej pasuje do sztuki niż do filozofii. Zapewne na tym polu myśliciel przeistaczał się w twórcę, a właściwie w stwórcę.
    /20-05-22

    Karol Tarnowski: Nauki szczegółowe są bardzo, bardzo ubogie
    W rozmowie z Zofią Zarębianką o Janie Pawle II, 17 maja 2020. Rozmowa transmitowana w Internecie przez Kluby Tygodnika Powszechnego, dla swoich członków. Cytat z pamięci. Notatka z dnia następnego, rano. Podwójne „bardzo” ma oddać zdecydowaną emfazę wypowiedzi.
    Komentarz: nauki szczegółowe, jak się wydaje, są tu opozycją do filozofii. Być może należałoby (można by) dodać filozofii człowieka, albo i „personalizmu chrześcijańskiego w ujęciu Karola Wojtyły”. Owe nauki szczegółowe to, nie pozostaje nic innego, jak: matematyka, fizyka, biologia, i dalej, medycyna i psychologia z psychiatrią, a także technika oraz, ostatnia, ze względu na autora poniższej notatki, geologia. Na podstawie innych wypowiedzi Profesora, można przypuszczać, że do nauk szczegółowych nie zalicza się sztuka, a w szczególności sztuki plastyczne, ani muzyka. Zapewne mają wyższy status. Podobnie jak poezja i literatura.
    /20-05-18

    Is Evolutionary Psychology Possible?
     …  human behaviors can be explained in evolutionary terms and that the core units governing our actions haven’t changed since the Stone Age
     …  hard-wired cognitive structures that are operating in all of us contemporary human beings the same way they did for our ancestors on the savannas
     …  a match between our modules and the modules of the prehistoric ancestors
     …  evolutionary theory is the only game in town to give us accounts of biological questions
     …  while we might talk about similarity and ancestry with respect to normal physical phenotypes, I am reluctant to go there with behaviors. /20-05-15

    Artificial General Intelligence
     …  David Chalmers .. is possible
     …  likely that we will soon have AI approximately as cognitively sophisticated as mice or dogs
     …  vast sums invested
     …  Our thinking involves not just some kind of simple on-off representation of things around us, but an entire emotional and value-laden involvement with the world itself. Computers have none of this.
     …  using formal logic .. failed to take account of the “fabulously rich and messy world we inhabit”
     …  “pre-given” ontology or structure for the world
     …  deep learning machines is their ability to detect patterns in large (sometimes huge) amounts of data
     …  Machine learning may not start with general rules which make ontological assumptions, but it does start with data that is already processed by humans
     …  AI machines are still tied up with the programmers’ own classifications of reality
     …  common sense cannot be captured in terms of the “rules and representations”
     …  correctly mapping an image onto a label: nothing more than that
     …  general intelligence is the general ability to solve cognitive problems
     …  Siri and Alexa do amazingly well in “recognizing” speech and synthesizing speech in response. But you very quickly get to the bottom of their resources and reach a “canned” response (“here are some webpages relating to your inquiry”).
     …  conversation is not an activity that has one easily expressible goal, and so the task for the Siri/Alexa programme cannot be specified in advance
     …  the human brain is just a complex biological (and therefore material) machine, it must be possible in principle to artificially reproduce what the human brain does
     …  the invention of the aeroplane did not require building something that flies in exactly the way a bird flies
     …  Watson can read millions of unstructured documents in seconds”. That’s not something we can do.
     …  AI .. splendid isolation from neuroscience
     …  two extremes: either that genuine artificial thinking machines are just on the horizon, or they are absolutely impossible in principle. /20-05-15

    The self
     …  Nietzsche .. What we experience in our dreams ... is as much a part of the overall economy of our soul as anything we 'really' experience
     …  the self can be understood as,
    i. reducible to part of the body (materialism),
    ii. a soul distinct from the material body (dualism),
    iii. a mind that creates what appears as matter (idealism), and
    iv. the self can be understood as being at one with an extended body (processism).
    The common view is undoubtedly i. and ii., the biological and the predominantly religious
     …  mind-matter view
     …  following Hume's .. the "self" to be an illusion of the mind
     …  Kant in response argues that though we cannot directly perceive the pure, underlying self, we must nonetheless assume it to exist (as "pure apperception") as that which holds all such experiences together as one – a bundle is a unity that, as such, must be tied.
     …  one can separate the conscious, the subconscious, and the self-conscious
     …  consciousness (awareness) of consciousness
     …  The self, for Nietzsche, can be both creator and creation.
     …  One may see oneself as the immortal centre of the universe, in Leibnizian fashion, or as a provisional, insignificant speck in the wider cosmos, a la Schopenhauer: "We can regard our life as a uselessly disturbing episode in the blissful repose of nothingness."
     …  memory .. a condition for maintaining a self-identity over time
     …  Psychedelics
     …  (often drug-induced) mystical state .. "when the characteristic sort of consciousness has set in, the mystic feels as if his own will were in abeyance, and indeed sometimes as if he were grasped by a superior power"
     …  One is at the mercy of .. another aspect of oneself .. not itself passive but excessively active
     …  Aldous Huxley .. "if you go to the antipodes of the self-conscious mind, you will encounter all sorts of creatures ... . You do not invent these creatures ... . They live their own lives in complete independence. A man cannot control them"
     …  "One" is at once both auditorium and stage. "One" is now "two", ad infinitum.
     …  experiences that are not memorized cannot be reported as phenomenological correlates
     …  "One" watches – or better, things are watched.
     …  it is this mnemonic river to which one normally identifies the self. But as mentioned, there may flow parallel streams which never hit this main river of the self – there may be many instances of extreme sentience that are not memorized.
     …  the speed of time is a child of the mind.
     …  The question of what the self is often presumes that there exists some definite boundary that we must decipher.
     …  the opening of individualization .. a sense of unity with that which we perceive
     …  The subject-object dichotomy evaporates
     …  Whitehead .. the subject's perception of an object is concretely part of that object .. organic realism
     …  Bradley .. "everything less than the Universe is an abstraction"
     …  The self under psychedelics is thus broken up, recreated, contracted, dilated, forgotten, reclaimed, de-culcated, sublimated, alienated, isolated, interfused, multiplied, unified, and eternalized. Psychedelics reap destruction upon the human condition, or from another angle, they heighten the human condition. Either way, the self is never the same again. /20-05-13

    Głupota jest wszechobecna, a nikt się nie boi, że może się zarazić.
     …  Podobno w austriackiej armii, za Franciszka Józefa, obowiązywała następująca reguła: oficerów klasyfikuje się według dwóch cech – głupoty i lenistwa. Głupich i leniwych należy kierować do sztabu – przynajmniej zminimalizują się szkody, jakie sztab i tak zwykle wyrządza. A głupich i pracowitych – na pierwszą linię frontu...
     …  przenosi się całą aktywność w świat wirtualny. Ale wirusowi głupoty w to graj!
     …  Co więc zalecam? Nośmy maseczki. Żeby nie zarażać innych.
    Michał Heller /PAUza nr 513 7 maja/20-05-10

    Wolfram
     …  path to the fundamental theory of physics
     …  physicists are unconvinced
     …  computational picture of the cosmos .. computer code .. one step at a time
     …  Even when the underlying rules for a system are extremely simple, the behavior of the system as a whole can be essentially arbitrarily rich and complex
     …  they cannot make any definite, concrete new predictions
     …  Why not go the traditional route? /20-05-07

    capitalism .. Hegel
     …  ever less regulated, “American-style” capitalism .. exploitative use of the power possessed by owners of capital
     …  the inherent injustice of a competitive system
     …  Platonic Socrates argued in the Republic, different types of regimes, including economic regimes, need to cultivate different types of souls
     …  Rousseau: Is life in a system of production generally defined by the division of and the sale of labor to private owners of capital who compete for market dominance a suitable or flourishing way to live for human beings?
     …  Hegel is known as a defender of bourgeois .. the evidence suggests that his answer to these questions is far more negative than is widely recognized
     …  material inequalities and the resulting systematic unfairness were important to him
     …  social bonds without which no society can survive
     …  Hegel .. Elements of the Philosophy of Right (1821)
     …  a human being can only be what it is, a free being, by participating in social institutions
     …  a unity of subjective and objective freedom
     …  Marx inherited from Hegel
     …  a Hegelian principle that is often not well understood: that no one individual can be said to be free unless all are /20-05-07

    Totalitarianism
     …  Paul Krugman .. “The pandemic will eventually end” .. “but democracy, once lost, may never come back. And we’re much closer to losing our democracy than many people realize”
     …  totalitarianism-“that most horrible of inventions of the twentieth century”
     …  Fidel Castro’s Cuba to Vladimir Putin’s Russia
     …  right-wing populism
     …  authoritarianism
     …  Mussolini .. “all within the state, none outside the state, none against the state”
     …  Stalinism and Hitlerism .. diametrical opposition on the political spectrum
     …  Arendt .. totalitarianism has discovered a means of dominating and terrorizing human beings from within
     …  Arendt and Orwell described are systems of government that have never actually existed. Neither Nazism nor Stalinism succeeded in controlling or dominating its citizens from within
     …  Totalitarian Dictatorship and Autocracy, published in 1956 by Carl Friedrich and Zbigniew Brzezinski
     …  China’s new social credit score .. But China’s .. market economy,
     …  Gestapo .. The Stasi was quite different .. totalitarianism, East Germany does not fit .. a welfare dictatorship, a participatory dictatorship, a thoroughly dominated society, a modern dictatorship, a tutelary state, and a late totalitarian patriarchal and surveillance state.
     …  a Cold War desire to classify fascist and communist dictatorships as essentially the same phenomenon
     …  And, indeed, the sophisticated data-mining techniques of Cambridge Analytica, which assisted the 2016 Trump campaign to manipulate voter choices, would have made the Stasi, the Gestapo, or the NKVD green with envy.
     …  totalitarianism’s usefulness as a distinctive category of government simply evaporates when we begin to look at all the ways in which technology has compromised individual privacy
     …  the destruction of the private sphere in the interest of the public good is precisely what theorists tell us lies at the heart of totalitarianism
     …  the idea of totalitarianism is a useless tool in assessing the decency of governance in any twenty-first-century state
     …  If we are to survive in this brave new world, in which technology makes it ever easier for governments to manipulate individual decisions, but in which we also demand that the state take an ever-larger role in ensuring our safety from ourselves, we must acknowledge that the Manichean worldview implied in the term totalitarianism is an outdated relic of the Cold War. /20-04-30

    Adam Zagajewski
    O podłości
    Podłości nie da się mierzyć jak temperatury czy odległości, gdyby jednak istniał podłościomierz, to ostatnie działania naszej szanownej rządzącej partii i jej ponurego przywódcy znalazłyby się na samym skraju pomiarów.
    Dążenie do głosowania w sytuacji, gdy nie mogło być żadnej kampanii wyborczej i gdy na majowych wyborach skorzystaliby tylko grabarze (jeden z nielicznych zawodów napychających sobie kieszenie w czasie pandemii), jest czymś niesłychanym, czymś, co musi budzić najżywszy protest ludzi dobrej woli.
    Wyborcza/20-04-28

    privacy
    IF THE EU had an official religion, it would be privacy. A devout priesthood ofEU officials and politicians preach that only their privacy laws can lead to salvation. Holy texts, such as the General Data Protection Regulation or the ePrivacy Directive, are held up as wisdom the whole world would be better off following. Such is the regulatory clout of Brussels that much of it often does. Those who break such strictures are smitten (or whacked with fines of up to 4% of global turnover). In an age of coronavirus, as policymakers ponder ways of ending the lockdown, this belief is being tested.
     …  Privacy has a price
     …  Any trade-offs between health and privacy
    The Econonimist, April 25th/Charlemagne/20-04-28

    Unknowing Gerhard Richter: Painting ..
     …  “Pictures which are interpretable, and which contain a meaning, are bad pictures.” A good picture “takes away our certainty, because it deprives a thing of its meaning and its name. It shows us the thing in all the manifold significance and infinite variety that preclude the emergence of any single meaning and view.”
     …  Richter is contemporary art’s great poet of uncertainty; his work sets the will to believe and the obligation to doubt in perfect oscillation.
     …  There is no school of Richter. His output is too quixotic, too personal
     …  His foggy photo-paintings suggested an oxymoronic lugubrious Pop, the random color squares an ebullient Conceptualism, and his soft-focus landscapes and portraits channeled both the Sturm und Drang of German Romanticism and the cool distance of contemporary photography.
     …  Beuys had recently arrived with his mystical cult of personality, the Zero group was developing its language of impersonal geometries, and Informel (Europe’s attenuated answer to New York School abstraction)
     …  in Düsseldorf was Sigmar Polke
     …  Richter’s art-historical allegiances were laid bare: Caspar David Friedrich, Vermeer, Velázquez—painters with a gift for inviting us through the illusory window while showing us how the trick was played
     …  “to create a well-built, beautiful, constructive painting. And there are many moments when I plan to do just that, and then I realize that it looks terrible. Then I start to destroy it, piece by piece, and I arrive at something that I didn’t want but that looks pretty good.”
     …  composition becomes the joint product of accumulation and knowing when to stop.
     …  I am more interested in pictures than in painting.
     …  The story always changes with the telling. Uncertainty is truth. /20-04-26

    Does the Pandemic Have a Purpose? Only if we give it one. The coronavirus is neither good nor bad. It wants only to reproduce.
     …  Nature doesn’t care about you.
     …  without appeal to God’s design or mystical idealism
     …  Darwinian evolution is true (corroborated by mountains of evidence)
     …  it isn’t even a drama because there is no plot in nature
     …  religious people see something benevolent in nature
     …  It is the universal instinct to find (or project) a plot in nature. A mythopoetic paradigm or perspective sees the world primarily as a dramatic story of competing personal intentions, rather than a system of objective, impersonal laws.
     …  It’s a prescientific worldview, but it is also alive and well in the contemporary mind.
     …  nature can be horrifying, but not evil (nor good)
     …  Disease and death are not bugs in the system, but features.
     …  natural selection works only because many more organisms are born than can survive to procreate
     …  formerly shamans and priests, now presidents and politicians
     …  As a naturalist, I resist the theological version of human exceptionalism, but as a philosopher, I’m inclined to recognize that nothing has intrinsic value until we humans imagine it so. Since we cannot find our species’ value objectively by looking at the neutral laws of nature, then we must just assert it. And simply affirm that the universe is more remarkable with us in it. /20-04-23

    The Coronavirus Is a Preview of Our Climate-Change Future
     …  rewriting the rules that have governed all life on this planet
     …  We have been living in a bubble, a bubble of false comfort and denial,
     …  “New universe” is not hyperbole .. the planet could harbor more than a million yet-to-be-discovered viruses — many of them, like COVID-19, for now “quarantined” in particular susceptible species, but which could evolve or “jump” into humans /20-04-11

    PAU
    Szanowni i Drodzy Państwo, Członkowie, Pracownicy i Przyjaciele Polskiej Akademii Umiejętności,
    Przeżywamy bardzo trudny czas, na skalę, której jeszcze dwa miesiące temu nikt z nas nie mógłby sobie wyobrazić. Długo żyliśmy w przekonaniu, że nasze bezpieczeństwo i dobrobyt są niezagrożone. Długo nie umieliśmy, a właściwie nie chcieliśmy zauważyć, że korzystamy z przywilejów, które nie były dane poprzednim pokoleniom w naszym kraju i o których mogą tylko marzyć miliony ludzi na Bliskim Wschodzie, w Afryce i niektórych krajach Azji. Okazało się to złudą. Nikt z nas nie wie, jak długo potrwa obecny kryzys, ale wszyscy wiemy, że po jego zakończeniu świat nie będzie już taki jak wcześniej. Musimy się na to przygotować, przemyśleć obecną sytuację, drogi wyjścia i drogi przyszłej odbudowy naszego życia społecznego, gospodarczego i naukowego. Mamy nadzieję, że potrafimy wyciągnąć poprawne wnioski. Nadchodzące święta Wielkiej Nocy uczą, że nie ma sytuacji bez wyjścia. Obyśmy wyszli z epidemii nie zrozpaczeni i osłabieni, a mądrzejsi i bardziej wzajemnie sobie bliscy, choć dzisiaj z żalem przeżywamy konieczną izolację.
    W imieniu Zarządu Polskiej Akademii Umiejętności pozwalamy sobie życzyć Państwu przede wszystkim wiele zdrowia i jak najpogodniejszych Świąt, w tym czasie trudnym, choć zachwycającym wiosennym słońcem.
    Jan Ostrowski
    Szczepan Biliński
    /20-04-09

    Genes that can’t express themselves
     …  Johann Wolfgang von Goethe .. “felicitous mobility and plasticity that allows them to grow and adapt themselves to many different conditions in many different places”
     …  epigenetic landscape .. how organisms might regulate which of their genes get expressed
     …  how we treat cancer and other aging-related diseases
     …  cells’ methylation landscape as a communication system
     …  Even adult cells have some degree of stochastic variation, or random fluctuation .. a cell showing it is still young and adaptable
     …  nature is more complex than we previously thought
     …  Claude Shannon .. a set of messages sent over a noisy channel
     …  DNA methylation is binary information that is either conserved, or not conserved, through time and cell division.
     …  The cellular machinery that regulates this epigenetic code is a rapidly developing area
     …  How responsive and sensitive a gene is to the machinery regulating its DNA methylation—so called “entropic sensitivity”—is critical for a cell’s function.
     …  aging cells are less responsive /20-04-07

    Uczeni
    Pięk­no przy­ro­dy jest po­dej­rza­ne.
    No tak, prze­pych kwia­tów.
    Na­uka dba o po­zba­wia­nie nas ilu­zji.
    Na­wet nie wia­do­mo, cze­mu jej tak na tym za­le­ży.
    Wal­ki ge­nów, ce­chy za­pew­nia­ją­ce suk­ces,
    Zysk i stra­ta.
    Ja­kim ję­zy­kiem, na Boga, prze­ma­wia­ją ci lu­dzie
    W bia­łych ki­tlach? Ka­rol Dar­win
    Czuł przy­naj­mniej wy­rzu­ty su­mie­nia
    Ogła­sza­jąc swo­ją teo­rię, jak mó­wił, dia­bel­ską.
    A oni co? Ich to prze­cie po­mysł:
    Po­se­gre­go­wać szczu­ry w osob­nych klat­kach,
    Po­se­gre­go­wać lu­dzi, nie­któ­re ich ga­tun­ki
    Od­pi­sać na ge­ne­tycz­ne stra­ty oraz wy­truć.
    "Py­cha pa­wia jest chwa­łą Boga" - pi­sał Wil­liam Bla­ke.
    Kie­dyś cie­szy­ło nam oczy
    Bez­in­te­re­sow­ne pięk­no, z sa­me­go nad­mia­ru.
    A co nam zo­sta­wi­li? Tyl­ko ra­chun­ko­wość
    Ka­pi­ta­li­stycz­ne­go przed­się­bior­stwa.

    Czesław Miłosz/20-04-05

            I przy nakryciach tych,
    którzy nie przyjdą, poprawiaj sztućce.

    Natalia de Barbaro/Ciemnia, 2010, str. 36/20-03-26

    Coronavirus Humanity Lacks Leadership, Youval Noah Harari
     …  Build walls, restrict travel, reduce trade.
     …  The real antidote to epidemic is not segregation, but rather cooperation.
     …  Epidemics killed millions of people long before the current age of globalization.
     …  the best defense humans have against pathogens is not isolation – it is information
     …  pathogens rely on blind mutations while doctors rely on the scientific analysis of information
     …  People believed in angels and fairies, but they could not imagine that a single drop of water might contain an entire armada of deadly predators.
     …  While medieval people never discovered what caused the Black Death, it took scientists just two weeks to identify the novel coronavirus, sequence its genome and develop a reliable test to identify infected people.
     …  Since a single person might host trillions of virus particles that undergo constant replication, every infected person gives the virus trillions of new opportunities to become more adapted to humans.
     …  providing better healthcare for Iranians and Chinese helps protect Israelis and Americans too from epidemics
     …  Today humanity faces an acute crisis .. due to the lack of trust between humans.
     …  people need to trust scientific experts, citizens need to trust public authorities, and countries need to trust each other
     …  irresponsible politicians
     …  2014 Ebola epidemic, the U.S. served as that kind of leader .. a similar role also during the 2008 financial crisis
     …  in recent years the U.S. has resigned its role as global leader.
     …  U.S. no longer has any real friends – it has only interests
     …  The void left by the U.S. has not been filled by anyone else. Just the opposite. Xenophobia, isolationism
     …  the crucial struggle takes place within humanity itself /20-03-19

    consciousness .. a brain process?
     …  We have a front-row seat, an unmediated first-hand awareness of what conscious experiences are like, and we know well-enough what brain processes are like. The two could not be more different.
     …  In the hands of philosophers, this sentiment is transmuted into the doctrine that consciousness cannot be identified with, or ‘reduced to’, anything physical.
     …  Our inability to extract truths about tables from truths about particles or fields is unremarkable: tables are, in this regard, irreducible. What would be remarkable is someone’s insisting that from this it follows that tables could not possibly be clouds of particles or disturbances in fields, because tables obviously differ from such things.
     …  Why not think the same of consciousness?
     …  talk of observing another’s experiences is patent nonsense
     …  each of us enjoys immediate access to our own conscious states
     …  Your brain is open to the public, not so your experiences.
     …  The tomato, not my experience, not my conscious state, is red and spherical.
     …  If you persist in the thought that redness resides in me, not in the tomato .. bifurcated the universe, and embraced a robust brand of dualism.
     …  not that dualism is false, only that it is by no means required
     …  My states, experiential or otherwise, are ‘private’ only in the sense that no one else could be in my state. Trivially, my states are my states.
     …  what is most perplexing about consciousness is not consciousness itself, but that so many find it perplexing /20-03-19

    coronavirus pandemic in five powerful charts
     …  rapid spread
     …  compare to other diseases
     …  publishing new coronavirus research
     …  affected carbon emissions and air quality
     …  compare to the 2003 SARS outbreak /Nature/20-03-19

    Consciousness Isn’t Self-Centered
     …  the atoms that compose your body were once the ingredients of countless stars in our universe’s past
     …  this particular configuration that is you .. experiencing something
     …  as far as consciousness is concerned there is nothing, and then suddenly, magically - something
     …  how does felt experience arise out of non-sentient matter?
     …  David Chalmers .. “hard problem” of consciousness
     …  which processes in the brain give rise to various functions, the hard problem lies in understanding why some of these physical processes have an experience associated with them at all
     …  panpsychism .. the possibility that all matter is imbued with consciousness in some sense
     …  why not the reaction of plants to light—or the spin of electrons
     …  a fundamental property of the universe
     …  Modern panpsychism is informed by the sciences and fully aligned with physicalism and scientific reasoning.
     …  We strongly believe .. that consciousness arises out of complex processing in brains. But
     …  split between a brain-based explanation and a panpsychic one
     …  if the individual atoms and cells in my brain are conscious, how do those separate spheres of consciousness merge to form the consciousness “I’m” experiencing?
     …  confusion of consciousness with the concept of a self
     …  Christof Koch .. a hypothetical experiment in which two brains were connected together as successfully as the two hemispheres of a single brain are connected
     …  split-brain patients
     …  would two brains wired together produce a new, integrated mind? .. constituting a new “person”?
     …  The human sense of being a self, along with an experience of continuity over time through memory, may in fact be a very rare form of content. /NAUTILUS/20-03-14

    Steven Pinker: Evolution Has Saddled Our Species With Many Irrational And Destructive Psychological Traits
     …  nature of cognition and the nature of journalism
     …  competition among social groups
     …  businesspeople to discredit governments, academics to discredit business, religious spokespeople to discredit secular organizations, and so on
     …  Enlightenment Now
     …  capitalism can coexist with many evils, as we see in authoritarian countries
     …  progress depended as well on science
     …  prosperity primarily comes from ideas, methods, recipes, algorithms, and other forms of knowledge, which are replicable at marginal or zero cost
     …  contrary to what most people think, life, health, prosperity, safety, peace, knowledge, and happiness are on the rise
     …  the world is gripped by irrationality and hysteria
     …  during the past decade the number of democracies in the world has hovered in a record-high range, with 99 democracies in 2018 compared to 87 in 1998, 51 in 1988, 40 in 1978, 36 in 1968, and 10 in 1918 /20-03-12

    machine learning MIT
     …  A powerful antibiotic that kills some of the most dangerous drug-resistant bacteria in the world has been discovered using artificial intelligence.
     …  vast digital libraries of pharmaceutical compounds
     …  the researchers first trained a “deep learning” algorithm to identify the sorts of molecules that kill bacteria. To do this, they fed the program information on the atomic and molecular features of nearly 2,500 drugs and natural compounds, and how well or not the substance blocked the growth of the bug E coli.
     …  To hunt for more new drugs, the team next turned to a massive digital database of about 1.5bn compounds.
     …  program returned a shortlist of 23 potential antibiotics
     …  to design potent new antibiotics from scratch /20-03-02

    I was a climate-change denier
     …  it’s no longer just an issue for hippies, science dweebs, and conspiracy theorists
     …  Polar bears will go extinct before I get a chance to eat one.
     …  Waaaay more umbrellas will get turned inside out.
     …  Everyone’s going to want to talk about the weather, blah blah blah, rather than just turning up the air conditioner.
     …  This isn’t about the future of planet Earth. It’s not about the human race. It’s about me. /20-02-26

    O naturze ludzkiej Roger Scruton
     … Mierząc się z poglądami psychologów ewolucyjnych, moralnych utylitarystów i filozofów materialistycznych takich jak Richard Dawkins i Daniel Dennett, Scruton przekonuje, że ludzi nie można rozumieć jako bytów czysto biologicznych. Jesteśmy czymś więcej niż ludzkimi zwierzętami
     …  Książka zaczyna się od sugestii Kanta
     …  nowy sposób rozumienia wpływu samoświadomości na kwestię, jak powinniśmy żyć /20-02-25

    search for extraterrestrial intelligence
     …  1990 .. turned the probe’s instruments back towards Earth .. to find out whether it was possible to detect evidence of life on the planet from a distance
     …  found methane and oxygen
     …  a sharp change in the reflectance of the planet at red wavelengths .. photosynthetic plant
     …  intelligence .. narrowband electromagnetic radiation .. an unmistakable indicator of technology
     …  the best way to find aliens is to look for unnatural radio signals
     …  better telescopes, faster computers, the discovery of thousands of planets circling stars
     …  James Webb Space Telescope .. Extremely Large Telescope (elt) in Chile
     …  Alien civilisations might, for example, use laser flashes as optical beacons to signal their presence.
     …  rings of satellites above a planet’s equator .. structures surrounding a planetary system’s star, put there to capture that star’s light as a source of energy
     …  searches for chemical biosignatures
     …  Trappist-1, 40 light-years from Earth .. habitable zone
     …  “Earth transit zone”—the part of the sky from which Earth itself would be detectable by the transit method
     …  So far, the skies have been quiet. But seti researchers are patient people. /20-02-22

    UNIWERSYTET

    Uniwersytet. Czerwona skała w morzu
    Kasztanów kwitnących bluźnierczo.
    Tłumy studentów, biegnących we wszystkie
    Strony: oddziały opuszczają pole bitwy.

    Szukałeś wiedzy, tak jakby mądrość dbała
    O neogotyckie budynki, cegły uniwersytetu.
    Twoi profesorowie przemawiali
    Jak bohaterowie niemych filmów.

    Także dawne pokolenia zjawiały się
    W amfiteatralnej, stromej sali –
    Powstańcy przegranych powstań,
    Szukający pocieszenia w nauce
    I chłopcy, którzy za wcześnie umarli na gruźlicę
    I wciąż są tacy chorzy
    (czekają na przebaczenie dla tych,
    Co żyli nieśmiało, lękliwie, lekko).

    Za oknem rósł ciemnobrązowy buk.
    W jego liściach kryło się inne posłanie,
    Inny szept. Inny uniwersytet.

    Adam Zagajewski, Płótno, 1990, 2016 /20-02-22

    Human Origins 'Ghost' DNA In West Africans Complicates Story Of ...
     …  50,000 years ago, ancient humans in what is now West Africa apparently procreated with another group of ancient humans that scientists didn't know existed
     …  Neanderthal .. Denisovans .. yet-to-be-discovered group
     …  the story is incredibly complex
     …  not clear whether there was a single interbreeding "event," though, or whether it happened over an extended period of time
     …  Do they have any kind of adaptive benefits?
     …  from multiple groups /20-02-18

    Free Will
     …  When we walk into a coffee shop, we think it is up to us .. .. about more serious matters—which job to apply .. up to us, too. Of course, what we do is constrained by our environments, means, and habits. We are susceptible to subconscious influences and nudges, as psychologists and marketing experts know too well. But there still seems some room for choice.
     …  scientists are telling us that free will is an illusion .. Sam Harris
     …  Yuval Noah Harari .. in the age of big data, “‘free will’ will likely be exposed as a myth”
     …  liberalism might lose its practical advantages
     …  physical processes in the brain
     …  Human beings are just complex physical machines
     …  Benjamin Libet in the 1980s
     …  The idea of free will is central to the way we understand ourselves
     …  Many of the world’s criminal justice systems are inhumane as well as counterproductive.
     …  Kant .. we must view ourselves as free when we engage in practical reasoning
     …  free-will skepticism .. is part and parcel of a reductionistic worldview
     …  René Descartes from which modern science has moved on
     …  it is a mistake to equate science with reductionism
     …  some form of free will, though liberated from supernatural undertones
     …  To be sure, future science might vindicate a reductionistic approach and explain human behavior without representing people as choice-making agents.
     …  So far, psychology, broadly speaking, has resisted reduction and has been augmented but not replaced by neuroscience. /20-02-18

    roots of culture and cognition
     …  Origin of Species .. “light will be thrown on the origin of man and his history.”
     …  emotional and cognitive similarities (homologies) of mammals
     …  emotional systems are central
     …  data from philosophy, biology and psychology
     …  algorithmic assumptions of cognitive science
     …  much older capacity – the power to feel and respond appropriately
     …  to think about consciousness itself as an archaeologist thinks about layers of sedimentary strata
     …  feelings, sculpted in the encounter between neuroplasticity and ecological setting, provide the true semantic contours of mind
     …  At the very bottom or at the “core” of the mindbrain are the instinctual drives .. in subcortical areas of the brain
     …  cognitive powers of the neocortex
     …  The biological and psychological sciences have historically isolated
     …  the lowest layers of mind permeate, infiltrate, and animate the higher layers /20-02-18

    Prawda przybliżona
     …  O prawdzie debatują też filozofowie.
     …  tzw. szeroka publiczność rozumie pojęcie PRAWDY zupełnie inaczej niż fizycy i inni przedstawiciele nauk przyrodniczych. Wydaje mi się też, że filozofowie (i chyba generalnie humaniści) niewystarczająco zwracają na to uwagę. Na czym polega różnica? Uczestnicy dyskursu publicznego występują najczęściej jako „rycerze prawdy”, którą traktują jako coś bezwzględnego, niepodlegającego wątpliwościom ani modyfikacjom. Tymczasem fizycy (i generalnie przyrodnicy) nie operują pojęciem prawdy bezwzględnej. Prawda fizyka nigdy nie jest absolutna, jest zawsze tylko PRZYBLIŻONA.
    Celem i ambicją fizyki jest bowiem poprawne opisanie rzeczywistości „materialnej”. Wynika stąd, że każda teoria, nawet jeżeli została wymyślona przez samego Einsteina, musi być przede wszystkim zgodna z doświadczeniem. Często się o tym zapomina. Usłyszałem na przykład na jednej z konferencji filozoficznych, że Paul Dirac „dowiódł istnienia świata antycząstek”. Dirac był teoretykiem i mógł co najwyżej wskazać TEORETYCZNĄ MOŻLIWOŚĆ istnienia antycząstek. Natomiast ich istnienie zostało udowodnione przez Carla Andersona, który w kilka lat potem odkrył antyelektron, przeprowadzając piękny EKSPERYMENT. Czyli każda teoria fizyczna (dotyczy to, rzecz jasna, również innych nauk przyrodniczych) jest weryfikowana przez porównanie z pomiarami wykonanymi w doświadczeniu. A należy pamiętać – i tu jest punkt kluczowy – że każdy pomiar czy obserwacja są zawsze obarczone pewną niedokładnością. Jeżeli więc zgodzimy się, że ostatecznym weryfikatorem naszej wiedzy jest eksperyment, który – z natury rzeczy – ma ograniczoną dokładność, to musimy się też zgodzić, że również prawa fizyki są ustalone tylko z pewną dokładnością. Innymi słowy, należy stale pamiętać, że tak zwana „prawda naukowa” jest tylko przybliżeniem. Dodajmy, że jest to całkowicie zgodnie z arystotelesowską definicją prawdy (bo zgodność z rzeczywistością możemy stwierdzić tylko z taką dokładnością, z jaką obserwujemy tę rzeczywistość).
     …  Traktowanie stwierdzeń nauki jako prawd bezwzględnych nie znajduje więc uzasadnienia ani w logice, ani w faktach. W dodatku jest ono również niebezpieczne dla samej nauki.
     …  Stąd już tylko krok do relatywizmu, a więc np. stwierdzenia, że astrologia jest równie prawdziwa (lub nieprawdziwa) jak astronomia.
    Andrzej Białas, PAUza 501, 13 lutego//20-02-14

    your own mind consciousness according to eliminative materialism
     …  political divide between mystics and materialists
     …  ‘keep your scientific hands off my consciousness mystery’
     …  The brain builds models of things in the world around you and models of its own internal events, and in every case the models are simplifications.
     …  What you intuit, think, and claim, are based on information constructed in the brain.
     …  I would say with certainty – that whatever consciousness you actually have, it is different from the consciousness that you think you have.
     …  the necessary gap between reality and what we intuit and think
     …  An internal dialogue? Sure .. Consciousness? Yes, indeed.
     …  when we introspect .. not electrical impulses and synapses, not interacting chunks of information, but something amorphous and ghost-like
     …  Philosophers have been trying to put words to that fuzzy extra essence for millennia, but none of the vocabulary really pins it down.
     …  Can we build similar networks, similar self-models, into artificial intelligence? /20-01-31

    Three Quarks and the Trinity: Scientific Models for a Mystery
     …  trying to understand the Trinity, the fundamental mystery of our Catholic faith
     …  candle comprises the wax, the wick and fire, three separate things but one entity
     …  the triangle
     …  Credo ut intelligam
     …  A SCIENTIFIC MODEL FOR THE TRINITY: QUANTUM SUPERPOSITION
     …  like Schrodinger’s cat
     …  measurement (either by collapse or by transfer to an alternate world/alternate mind–see Free Will and God’s Providence, Part IV)
     …  God the Father as the author of the Universe, of the laws of nature and mathematics
     …  God the Son as our salvation
     …  God the Holy Spirit to change us, to alter our mind and heart to be better
     …  When we seek God in any of these modes, we reach to God as that person of the Trinity, we “decompose” the superposition, we collapse the Trinity to the person that we seek.
     …  these models are an aid to understanding, not a true explanation
     …  A SCIENTIFIC MODEL FOR THE TRINITY: CARBONATE ION STRUCTURES
     …  A SCIENTIFIC MODEL FOR THE TRINITY: QUARKS IN A PROTON?
     …  A proton is presumed to be stable
     …  it is practically impossible to separate the quarks
     …  The proton, like God, is a fundamental indivisible entity. (The case for the proton being indivisible is not as strong, however, as that for God.)
     …  the Holy Trinity is a mystery. We can give examples, use models, but these are only aids to understanding; they are not complete explanations.
     …  Aquinas has said ‘God is rational, it’s only our minds that are limited. /20-01-28

    quantum physics
     …  Quantum entanglement is at the centre of a mathematical proof.
     …  how much coordination nature allows between distant objects .. the answer is, in principle, unknowable.
     …  complexity theory
     …  a team of two players who are able to coordinate their actions through quantum entanglement .. This enables both players to ‘win’ much more often than they would without quantum entanglement. But it is intrinsically impossible for the two players to calculate an optimal strategy, the authors show. This implies that it is impossible to calculate how much coordination they could theoretically achieve.
     …  Connes embedding problem
     …  quantum systems that cannot be approximated by ‘finite’ ones
     …  basic conviction that “nature is in some vague sense fundamentally finite”
     …  The confluence of complexity theory, quantum information and mathematics means that there are very few researchers who say that they are able to grasp all the facets of this paper. /20-01-27

    Abp. Życiński o wiedzy przyrodniczej (usłyszane w radiu)
     …  Co nam może fizyka powiedzieć o cierpieniu, może podać skład chemiczny łez ... /Radio Dwójka, "Kwadrans bez muzyki", Sylwia Sułkowska (o JP2) 20-01-24

    Greta Thunberg And George Monbiot Have Made A Short Film On The Climate Crisis /20-01-18

    living robots
     …  stem cells from frogs
     …  These are entirely new lifeforms. .. They are living, programmable organisms.
     …  less than 1mm long
     …  designed by an “evolutionary algorithm” that runs on a supercomputer
     …  The program starts by generating random 3D configurations of 500 to 1,000 skin and heart cells.
     …  have enough fuel inside .. to survive for a week
     …  Xenobots .. Xenopus laevis
     …  By building them out of mammalian cells, they could live on dry land.
     …  future variants could have nervous systems and be selected for cognitive capability
     …  The aim is to understand the software of life
     …  living creatures or machines /20-01-18

    Ginkgo biloba near-immortality
     …  more than 3000 years
     …  real genetic evidence for something scientists have long suspected: “The default condition in plants is immortality”
     …  genes in the cambium, they found no difference between young and old trees
     …  Most trees, however, appear to die from “accidents” such as pests or droughts. /20-01-18

    PAUza
    Technologie magazynowanie energii
    • Mechanicznymi (– magazynowanie w elektrowni szczytowo-pompowej, magazynowanie sprężonego powietrza, wirujące zasobniki energii z kołem zamachowym);
    • Chemicznymi (– power-to-gas – produkujące wodór metodą elektrolizy, który następnie zostaje przetworzony na metan, wykorzystując do tego procesu energię elektryczną );
    • Elektrochemicznymi (akumulatory);
    • Elektrycznymi (superkondensatory).
    Jerzy Niewodniczański: Elektrownia jądrowa w Oświęcimiu? .. SYNTHOS .. BWR (z wodą wrzącą) 300 MWe, SMR (Small Modular Reactors) /20-01-11

    chaos in the nervous system
     …  Two simple pendulums that swing with perfect regularity can, when yoked together, move in a chaotic trajectory. Given that the billions of neurons in our brain are each like a pendulum, oscillating back and forth between resting and firing, and connected to 10,000 other neurons, isn’t chaos in our nervous system unavoidable?
     …  Chaos is extremely sensitive to initial conditions
     …  the idea that the brain is nothing more than a complicated, but fundamentally rule-based, computer
     …  chaos could grant our brains a great deal of computational power, by exploring many possibilities at great speed
     …  chaos is actually deterministic .. on short time scales
     …  stable patterns called “attractors”
     …  a fine balance between reliability and exploration
     …  dynamical substrate of free will
     …  neuropil, the extracellular mix of axons and dendrites, is the organ of consciousness
     …  chaos is often handled with a semi-mystical reverence
     …  evidence comes from single cells
     …  depending on the external sodium concentration. Between these extremes, it exhibits unpredictable bursting that resembles the wandering behavior of a chaotic trajectory
     …  critical regime
     …  1/f noise
     …  the brain’s main function is to protect us from chaos
     …  presentation of a stimulus reduces variability
     …  order and chaos can co-exist in surprising harmony, in so-called chimera states
     …  connectome—a neuron-by-neuron map of the brain .. due to the complexity of these circuits, a structural map alone will not get us very far
     …  Individual neurons .. may not be “byte-addressable”
     …  dynamic dictionary that constantly shifts to make room for new meaning
     …  chaos theory as “destroying math from within”
     …  replacing the clear linear relationships we seek in nature with the messy and unpredictable
     …  self-interest .. we are terrible at predicting what that is .. It’s precisely this failure that makes us what we are. /20-01-09

    artificial intelligence alter our appreciation of art
     …  to explore the relationship between creativity and randomness
     …  grander goal of creating machines that would “improve themselves”
     …  There are more resonances between programming and poetry than you might think. Computer science is an art form of words and punctuation, thoughtfully placed and goal-oriented, even if not necessarily deployed to evoke surprise or longing.
     …  Programming has its own sense of minimalist aesthetics
     …  Ada Lovelace, the acknowledged first programmer ever, was Lord Byron’s daughter
     …  A limerick is, in some sense, described by an algorithm: A Mad Lib–ish start (“There was a(n) [old man / young lady] [from / with / who] ... ”), followed by five lines of prescribed meter in an aabba rhyme scheme.
     …  deep-learning machines need more inputs than the average school kid
     …  The Turing Test has long been a standard for assessing artificial intelligence, but, in the context of making art—rather than simulating consciousness—it may not be the most valuable, or the most interesting, metric.
     …  Some writers—just a few now, but surely more in the future—are using computers as creative collaborators.
     …  deep-learning program could complete sentences and even paragraphs
     …  their creative powers in a new light. We might even be moved by them.
     …  Can a machine write poetry? What is poetry? /20-01-09

    Don’t Believe a Word
     …  So much more is now known about how language evolves, how animals communicate and how children learn to speak.
     …  Why do millennials speak their own language?
     …  language is going to the dogs .. it is unscientific nonsense
     …  human communication is in constant flux
     …  a snapshot of a time, place and particular community of speakers
     …  dolphins had accents
     …  young people break and remake language. But so do poets.
     …  Noam Chomsky’s point that most human speech is internal and exists as thought /20-01-06

    Democracy is hard work.
     …  citizens must do a lot of thinking and talking about politics
     …  It requires us to maintain a peculiar moral posture toward our fellow citizens.
     …  a citizen's duty is to promote justice
     …  Not only do we increasingly interact only with those who share our politics
     …  our partisan identities
     …  if we are to perform well as democratic citizens, we need to see in our fellow citizens something beyond partisan affiliation /20-01-03

    PAUza
    Dysonans moralny; polskie fatum z perspektywy socjologa, PIOTR SZTOMPKA
    PISA .. Zarówno w Singapurze, jak i Polsce istnieje plaga korepetycji, podczas gdy w Finlandii płatne korepetycje są prawnie zabronione.
     …  W Polsce – dzieci muszą opanować pamięciowo wiele faktów z każdego przedmiotu z osobna, choć nie zawsze istnieje korelacja czasowa między tymi przedmiotami. Mało przeciążeni uczniowie fińscy mają czas na to, by podczas snu, spaceru lub swobodnej rozmowy ich umysły mogły "przetrawić" i uporządkować pozyskane informacje, co po latach zaowocuje innowacyjnymi rozwiązaniami dla dobra ich kraju. Polscy uczniowie - przeciążeni nauką w szkole, na płatnych korepetycjach oraz w domu, uczą się w myśl "zasady trzech Z": zakuć, zdać, zapomnieć.
     …  Niestety, ta sama zasada funkcjonuje u nas również na wyższych szczeblach nauki, w tym na uniwersytetach, z których wywodzą się nauczyciele.
     …  W Finlandii o jedno miejsce na studiach nauczycielskich konkuruje 10 osób, a prestiż nauczyciela jest równy prestiżowi lekarza. /20-01-03

    Galileo’s Error .. a new science of consciousness
     …  Arthur Eddington and Bertrand Russell
     …  the myth that David Chalmers “swept away decades of evasion” of the question of consciousness in 1995 and “forced us to confront the real mystery head-on”
     …  Thomas Nagel’s article “What Is It Like to Be a Bat?” (1974), John Searle’s “Chinese room argument” (1980), Frank Jackson’s parable about Mary and the black and white room (1982) and Robert Kirk’s 1974 revival of Descartes’s “zombie argument” (in philosophy, “zombies” are imaginary creatures who seem just like us but lack consciousness).
     …  Panpsychism is a wholly materialist view in almost all its versions
     …  “consciousness is located in the intrinsic nature of the physical world”
     …  people who think materialism requires them to deny the existence of consciousness, “illusionists” who are adamant that our brains are machines and there is really no feeling, no pain, no joy, no sensory experience. They are, however, a recent and wildly anomalous group among materialists, and this is unsurprising, because illusionism is the silliest view about reality that has ever been held by any human being. (No one has ever really suffered in any way!)
     …  you can’t solve the problem of consciousness by denying its existence
     …  1931: Ernst Schrödinger (“the material universe and consciousness are made out of the same stuff”), Louis de Broglie (“I regard consciousness and matter as different aspects of one and the same thing”) and Max Planck (“I regard consciousness as fundamental”). But they could see further than most of us. /20-01-02

    virtue signalling
     …  virtue signalling ‘cheapens’ moral discourse
     …  Perhaps, in fact, virtue signalling, or something like it, is a core function of moral discourse.
     …  The peacock’s tail .. biologists call an honest signal
     …  Humans .. wearing an expensive suit and a Rolex watch is a hard-to-fake signal
     …  religious behaviour can be understood as costly and credibility-enhancing signalling .. abstinence from sex except in certain contexts .. are costly not only in everyday terms, but also in evolutionary terms
     …  Why, from an evolutionary point of view, would someone signal religious commitment? .. to secure the benefits of cooperation
     …  in small groups we can keep track of who is honest
     …  The religious person signals her commitment to a code
     …  the prominence of Quaker business people in the early years of the industrial revolution
     …  if people would virtue signal when no one was watching
     …  Dishonest signalling is also widespread in evolution. .. some animals mimic the honest signal that others give of being poisonous .. some human virtue signallers are engaged in dishonest mimicry too
     …  dishonest signalling is worth engaging in only when there are sufficiently many honest signallers .. So on the whole, virtue signalling has its place in moral discourse, and we shouldn’t be so ready to denigrate it. /20-01-02

    2019

    The Art of Not Concluding Can philosophy be worth doing?
     …  the fact that a philosophy degree enables students to flee to more lucrative pastures is hardly a recommendation for philosophy itself
     …  what, if anything, gives anyone license to love philosophy?
     …  The question is whether professional philosophers—with academic appointments and articles in peer-reviewed journals, should they be so improbably lucky—serve any social function.
     …  Many (maybe most) avowed utilitarians are philosophers, so presumably there is some reason to think it is welfare-maximizing for at least some people to spend their lives arguing for utilitarianism in philosophy journals
     …  whether philosophy makes progress, as the sciences do
     …  no reasonable person could consider philosophy a truth-finding enterprise
     …  72.8 percent of philosophers leaned toward atheism, and not even close to 70 percent of the participants agreed about anything else
     …  the inescapable ghosts of understanding
     …  Russell .. pessimistic: The questions of philosophy, he has it, “must remain insoluble to the human intellect.”
     …  neuroaesthetics, which seeks to make falsifiable pronouncements about the nature of beauty
     …  brain-based theory of beauty .. mOFC .. active during the experience of musical and visual beauty
     …  philosophical problems are “not answered or solved,” but induced to “disappear.”
     …  the resolution of a problem involves its liquefication, its transformation into a nonproblem
     …  We could never succeed at “solving the problems,” either in novels or in essays. What we come to see in the course of our conversion into philosophers is that life would be brutally boring if we could. /19-12-19

    Why we need religion
     …  religious .. help protect and manage our emotional life with unparalleled and probably irreplaceable success
     …  a management system for our emotional lives that helps the human organism stay healthy and well
     …  Both cognitively and affectively, religion helps us cope with grief.
     …  we have colour vision because there are differences in wavelength in the world. We have depth perception because the world actually does exist in three dimensions. By the same logic someone might be tempted to say that if we have a ‘God module’ there must be a God it’s an adaptation to. /19-12-05

    computers are creating an extraordinary new world of images, sounds, and stories such as we have never experienced before
     …  whether machines can be creative and produce art, the question should be, ‘Can we appreciate art we know has been made by a machine?’
     …  word.camera .. It takes a picture—identifies what it’s seeing, then generates words—poetry—sparked by the images it has identified.
     …  A machine that can caption images is a machine that can describe or relate to what it sees in a highly intelligent way.
     …  computers as assisting us and providing intelligent augmentation
     …  machines creating on their own volition .. need not replace human creativity and will work in conjunction with human creativity
     …  In the future, we can expect computers to produce literature different from anything we could possibly conceive of. .. As we learn to appreciate it, perhaps we will even come to prefer machine-generated literature. /19-12-05

    To make money, study maths or economics at a top university
     …  Liberal-arts students will earn less, even if they go to Harvard
    /The Economist/19-11-29

    deep-learning AIs are so easy to fool
     …  facial-recognition systems by sticking a printed pattern on glasses or hats
     …  from automated telephone systems to user recommendations on the streaming service Netflix
     …  brilliant at what they do until, taken into unfamiliar territory, they break in unpredictable ways
     …  hacker could use these weaknesses
     …  to augment pattern-matching DNNs with extra abilities: for instance, making AIs that can explore the world for themselves, write their own code and retain memories
     …  DNNs do not actually understand the world
     …  by altering a few pixels .. ‘adversarial examples’
     …  It’s a type of mistake we would not have imagined would happen.
     …  With great power comes great fragility
     …  DNN should not change its output as a result of small changes in its input, and that this property might be mathematically incorporated into the network
     …  “We know from prior experience which features are the salient ones” .. “And that comes from a deep understanding of the structure of the world.”
     …  symbolic AI .. hard-coded rules about how the world worked .. rule-based AI
     …  Learning about causality needs to be done by agents that do things in the world, that can experiment and explore
     …  manipulate the world and create their own data through their own actions
     …  Over several days of non-stop sifting, the robot starts to get a feel for these alien objects and what it can do with them.
     …  gives an AI a much richer understanding of objects and the world in general
     …  A baby doesn’t learn by downloading data from Facebook
     …  Learning how to learn .. AI was guided in how best to learn from its environment .. next step in AI will be to give DNNs the ability to write their own such algorithms, rather than using code provided by humans /19-11-27

    /New Yorker/19-11-23

    Black Holes .. a misstep in Stephen Hawking’s
     …  The laws of quantum mechanics insist that information about the past is never lost
     …  a bridge to the black hole’s interior, an escape route for trapped data
     …  spying on a black hole from a higher dimension
     …  holography
     …  information should safely escape black holes
     …  the black hole interior became geometrically linked to portions of the exterior
     …  outgoing black hole radiation may look random to a passing astronaut doing simple experiments but rigorous study would reveal subtly hidden information
     …  a detailed account of how it is encoded in the radiation is still lacking
     …  not an operational description for how to extract the information
     …  the hologram within a hologram /19-11-22

    Beetles Navigate Via the Milky Way, First Known in Animal Kingdom
     …  dung beetles .. Scarabaeus satyrus .. the first known species to do so
     …  The tiny insects can orient themselves to the bright stripe of light generated by our galaxy
     …  already knew .. detecting a symmetrical pattern of polarized light that appears around the sun
     …  could still roll a ball in a straight line even on moonless nights
     …  Johannesburg Planetarium
     …  2013
     …  [aw: żuk gnojowy widzi drogę mleczną (korzysta z tego), jako jedyne zwierzę, poza człowiekiem] /19-11-21

    Self-Consciousness
     …  how we can fit consciousness, or the mind, into a mindless universe
     …  how can we know ourselves as knowers
     …  If I'm conscious of consciousness, if I'm consciously thinking about thinking, I change the state that I'm targeting
     …  Superintelligence is a threat to us, therefore, we urgently need to figure out who that is: us.
     …  minimal neural correlate of consciousness
     …  a human being is the kind of animal that sometimes leads a life in light of the question of how it fits into the mindless universe
     …  Some people mistakenly believe that they have an immortal soul .. Billions of people
     …  Other people think that they are sophisticated killer apes designed to spread their genes.
     …  evolutionary psychologist who thinks that mental states are fundamentally adapted
     …  Humans are not just any old animal, they are animals trying very hard not to be animals.
     …  our whole conscious mental life is a kind of illusion
     …  postmodern confusion
     …  "continental/European" and "analytic" philosophy
     …  How do I know that I'm not in a simulation?
     …  brutal idealism, according to which our minds are transcendent affairs that mysteriously peep into the universe
     …  New Realism
     …  There is actual objectivity.
     …  there is no single overall theory for all the facts
     …  The continuum hypothesis in mathematics is not solved by a physical theory of everything because numbers are not physical objects; you cannot investigate them with experiments, you cannot causally interfere with them in order to measure their behavior.
     …  Numbers are not spatiotemporally located.
     …  Quine suggested that ontology should not be metaphysics /19-11-20

    Neutrinos .. Basic Math
     …  the strange behavior of .. neutrinos
     …  eigenvectors
     …  the physicists could hardly believe they’d discovered a new fact about such bedrock math
     …  differences in the behavior of neutrinos and antineutrinos could be what allows matter to dominate over antimatter in the universe
     …  three-by-three matrix describes these oscillations
     …  CP violating phase /19-11-17

    John von Neumann The Unparalleled Genius of John von Neumann
     …  It is indeed supremely difficult to effectively refute the claim that John von Neumann is likely the most intelligent person who has ever lived. /19-11-17

    cleverer, better-looking children genetic profiling
     …  “playing God”
     …  a child optimised with the best-available genetic profile for a long and healthy life
     …  Single-nucleotide polymorphism (snp, or “snip”) profiling
     …  height and, more controversially, intelligence
     …  generation on generation, to improve grandchildren and great-grandchildren still further
     …  snps are the smallest possible differences between individuals’ dna—single genetic letters.
     …  assortative mating .. intelligent, successful (and therefore probably rich) people seek each other out as partners
     …  Piled generation on generation, however, it really might create a genetic elite.
     …  “Brave New World” /19-11-13

    Now, we’re in quite a different era.
     …  artificial intelligence .. quantum machine learning, but .. a little perspective about Moore’s law
     …  not that Moore’s law is ending, but it’s fragmenting into a variety of different kinds of systems
     …  Field-programmable gate arrays .. Neuromorphic computation
     …  analog versus digital .. quantum mechanics is both analog and digital
     …  by far the largest amount of information processing going on in the human body is not in the brain .. on at the level of DNA and RNA, which is the ultimate digital forum for information, because quantum mechanics makes nature digital
     …  a certain number of types of atoms, which combine to make a large but countable number of molecules. They can be in different places. Somewhere, billions of years ago, living systems figured out how to harness this very microscopic digital nature of nature into encoding genetic information into DNA and RNA, and into the receptor dynamics and the receptors in cells.
     …  genetic reproduction in a cell .. there are 1018 operations per second .. the brain has roughly 1011 neurons, 1015 synapses, and is going at 100 hertz—that’s only 1017 operations per second .. This has been going on for billions of years.
     …  Silicon Valley billionaires seem to believe that the singularity is there and that they themselves will be uploading their consciousness into a computer sometime in the near future
     …  if you uploaded yourself to the cloud, even if it were entirely successful and you found yourself as yourself in the cloud but unable to go out for a cappuccino, you might feel that you’d struck a Faustian bargain by definition
     …  One of the ways that we achieve immortality is by having close relationships with other people—by getting married .. that was too much trouble, even having a girlfriend .. rather upload himself into the cloud than actually have a girlfriend. That was a much easier process.
     …  vast amounts of information processing power—that, in the not-so-distant future .. likely to happen in the next half century or so, though it’s not going to be by a von Neumann architecture. It’s going to have to be by a variety of different methods.
     …  our possession of human language .. to think and communicate .. a cooperative power as a global organism
     …  the way people use their memory, given that they have immediate access to Internet search, changes a lot
     …  quantum computers .. simulating other physical systems, an application proposed by Richard Feynman
     …  deep neural networks, or Boltzmann machines, or deep learning that if you build a device that can generate certain kinds of statistics, it can often be used to recognize similar kinds of patterns
     …  find patterns in nature for things that you could never do on a classical computer
     …  Even with Google’s 50-qubit superconducting quantum computer, you could in principle diagonalize a 1012 by 1012 matrix, something which would take Avogadro’s number of operations ordinarily, and you’re not going to do that classically for quite a while.
     …  the machine with a true element of randomness was different than a classical machine; it just wasn’t different in the way that was helpful
     …  neurons and synapses are noisy because there are small numbers of chemicals
     …  The best strategies then are these probabilistic strategies.
     …  there have been scientific applications where pseudorandom numbers ran into trouble
     …  Once you start pressing Moore’s law, your systems are going to be noisy .. to be quantum mechanical .. semiquantum .. semicoherent .. will be the most powerful computers that you could build, where you have to deal with noise and you have to deal with quantum mechanics.
     …  what’s the difference between a neural net that’s been trained and a program that’s been written into memory
     …  computers .. if we socialize them .. they then are part of our human intelligence and not separate from it in the same way that books are not separate from our intelligence
     …  /Edge/19-11-04

    Musical Octaves Are Learned, Not Wired in the Brain
     …  Singing experiments with residents of the Bolivian rainforest
     …  We need to understand that interplay between our genes and our experience
     …  the perceived organization of musical pitches into octaves is a cultural artifact
     …  Musical systems around the world and across historical eras have been diverse, but octaves are commonly a feature of them.
     …  Tsimané volunteers to listen and sing. A machine played two notes, one after the other, and the subject would sing them back into a microphone. The researchers played pairs of notes different distances apart on the scale and in different pitch ranges.
     …  Neuroscience has offered few concrete ideas about how octave equivalence might operate in the brain, but the physical basis for octaves made it seem credible to many researchers that our perception of them might be hard-wired into the auditory cortex.
     …  how much of our behavior and perception is innate /19-11-01

    Ethical research
     …  Darwin .. morality and ethics could have no basis in nature, because nature had no purpose
     …  controversial biomedical applications such as organ transplants and in vitro fertilization (IVF)
     …  the first encyclopaedia of bioethics, published in 1978
     …  a higher quality of life could now be worth dying for
     …  Today .. from gene-edited babies and neurotechnology to dish-grown organoids and nanobots, the fraught relationship between society and research is once again front and centre.
     …  Much basic science is privately funded and therefore secretive.
     …  mergers between machine learning and biological synthesis raise additional concerns
     …  successful international regulation are rare
     …  CRISPR twins, synthetic neurons and self-driving cars
     …  The field no longer relies on philosophically derived mandates codified into textbook formulas.
     …  pragmatic instruments
     …  three-parent embryos
     …  the moral status of the human embryo, in favour of a sentimental concession
     …  the moral idea of society
     …  Today, interdisciplinary expertise plus extensive and creative public consultation increasingly define a new approach to ethical science. .. far beyond that of bioethicists and philosophers
     …  fake news, the new holy grail is the ability to create trustworthy systems for governing controversial research such as chimeric embryos and face-recognition algorithms
     …  expert knowledge and reliable data are essential but never enough to enable enduring, humane governance to emerge
     …  It turns out that what we have in common is less a single biological essence — or the ability to alter it — than a shared responsibility for human and non-human futures. /19-10-31

    Decline of Christianity In U.S., at Rapid Pace
     …  Pew Research Center
     …  atheist, agnostic or “nothing in particular,” now stands at 26%, up from 17% in 2009
     …  Both Protestantism and Catholicism are experiencing losses
     …  Large generation gap in American religion /19-10-31

    transition from quantum to classical objects
     …  A quantum-computing algorithm .. opens a new window on the connection between the quantum and classical worlds
     …  A quantum system lacking interference can be described using classical rules rather than quantum ones. The newly developed algorithm searches out interference-free solutions, known as consistent histories
     …  For systems of a few atoms, finding consistent histories is fairly trivial. For systems made up of many pieces, however, quantum-to-classical transition calculations are notoriously difficult to solve.
     …  Similar to how an atom exists as a quantum cloud rather than at a single point, data in a quantum computer is not a single number but a superposition of many numbers.
     …  quantum computers powerful enough to solve meaningful problems don’t exist just yet /19-10-31

    quantum supremacy
     …  a quantum computer that solved an incredibly hard problem in 200 seconds — a problem the world’s fastest supercomputer would take 10,000 years to solve
     …  a traditional supercomputer could solve the problem in 2.5 days, not 10,000 years
     …  to crack the toughest security protocols
     …  what it does or what it’s used for
     …  Actually, on and off aren’t really words that make sense in quantum physics.
     …  superposition
     …  entangled
     …  the smallest particles in nature don’t really exist in a point in space but they exist as a probability of existing
     …  a single qubit can contain exponentially more information than a normal bit
     …  Quantum computers don’t really do anything practical yet.
     …  The test problem Google ran .. to see if a random number generator was truly random.
     …  to use quantum computers to simulate the frenzied world of quantum mechanics and better understand it
     …  design new chemical reactions /19-10-30

    Why poetry matters
     …  we need the right words in order to survive
     …  speech that can survive
     …  turning noise into music
     …  liberates the reader (and writer) from a “prefabricated world”
     …  sterile debates over “high art” and “popular art”
     …  our actual encounter with the animal world, especially wild animals, is shrinking at an unprecedented rate (remember the recent press stories about junior dictionaries that no longer include the names of wild flowers or common birdlife)
     …  our passion to “understand” poetry may derive from “a middle-school confusion of literature and theology”
     …  why this or that writer or group of writers is absent (in an ideal world, I’d have liked to hear more from Poland, from Czesław Milosz and Wisława Szymborska)
     …  a serious analysis of the various sorts of “noise” around us that need turning into music
     …  The Music of Time: Poetry in the Twentieth Century, John Burnside /19-10-30

    In Poland, single women who have frozen embryos are now barred from accessing them.
     …  Rhetoric against in-vitro-fertilization takes a number of forms in Poland, where the technology has become a screen onto which its opponents can project a wide range of fears.
     …  Vatican’s absolute opposition to IVF .. PiS
     …  opposition to IVF is not driven solely by religion
     …  what they called the West’s “civilization of death.”
     … /The New Yorker/19-10-23

    evolution builds genes from scratch
     …  genes do not always evolve from existing ones, as biologists long supposed. Instead, some are fashioned from desolate stretches of the genome that do not code for any functional molecules.
     …  de novo genes could be quite common .. at least one-tenth of genes could be made in this way
     …  Their existence blurs the boundaries of what constitutes a gene, revealing that the starting material for some new genes is non-coding DNA
     …  1970s .. Each new gene must have arisen from an already existing gene.
     …  what is a gene?
     …  genes-in-waiting .. proto-genes .. non-coding material
     …  Gene duplication is a “very conservative mechanism” .. de novo genes, by contrast, are likely to produce markedly different molecules
     …  human genome .. de novo genes .. their roles in health and disease
     …  We know that what makes us human is our brains
     …  experiments with human organoids — cultured cells that serve as a model organ
     …  evolution can readily make something from nothing /19-10-23

    Brain seems to categorise death as something that only befalls other people
     …  Warning: this story is about death. You might want to click away now.
     …  against the grain of our whole biology, which is helping us to stay alive
     …  we shield ourselves from existential threats /19-10-23

    evolutionary underpinnings of mammals’ selflessness
     …  Three myths about morality remain alluring: only humans act on moral emotions, moral precepts are divine in origin, and learning to behave morally goes against our thoroughly selfish nature.
     …  ethology, anthropology, genetics, and neuroscience
     …  self-sacrifice .. has been documented in many mammalian species
     …  The idea of a divine lawgiver likely played no part in their moral practices for some two million years, emerging only with the advent of agriculture and larger communities where not everyone knew everyone else.
     …  Attachment to others, mediated by powerful brain hormones, is the biological platform for morality.
     …  our amazing cortex comes with a cost, and that cost is profound immaturity of the newborn
     …  Evolution’s trick was to expand the wiring for care from “me” to “me and mine.” /19-10-23

    Profesja: nauczyciel ... tekst pani Deborah Meier z Nowego Jorku. Pani Meier uważa, że najważniejszym zadaniem nauczyciela jest uczenie DEMOKRACJI. Dokładnie przy tym wyjaśnia, co przez to rozumie: trzeba wyrobić w uczniach NAWYK zadawania kilku podstawowych pytań:
    - Skąd to wiem i jakie są na to dowody?
    - Czy wszyscy się z tym zgadzają, czy też mają inne poglądy – jakie one są?
    - Jak ten element wiedzy łączy się z resztą mojej wiedzy? Czy jest w tym jakaś prawidłowość?
    - Czy widzę jakieś korelacje albo związki przyczynowo- -skutkowe?
    - Zakładając, że to czy tamto byłoby inne, co jeszcze by się zmieniło? Jak bym się tego dowiedział?
    - Kogo to obchodzi? Czy to ważne? Dlaczego?
    /Andrzej Białas/PAUza 484/19-10-21

    is it science?
     …  multiverse .. science based on zero empirical evidence
     …  the so-called Many-Worlds interpretation of quantum mechanics .. we can’t ever experience these other universes
     …  In our post-truth age .. dangerous antiscientific propaganda – ranging from climate-change denial to the anti-vaxxer movement to homeopathic medicines
     …  theories and empirical facts
     …  history tells us quite unequivocally that science works
     …  The progress of science is the reason we have smartphones, when the philosophers of Ancient Greece did not.
     …  Albert Einstein’s .. the Global Positioning System .. errors .. up to 11 kilometres per day.
     …  Karl Popper
     …  if we can’t make use of falsifiability, what do we use instead?
     …  Popper: .. the criterion of demarcation cannot be an absolutely sharp one but will itself have degrees. There will be well-testable theories, hardly testable theories, and non-testable theories. Those which are non-testable are of no interest to empirical scientists. They may be described as metaphysical.
     …  Today, we’re blessed with two extraordinary theories. The first is quantum mechanics. This is the basis for the so-called standard model of particle physics that describes the workings of all known elementary particles. It is our best theory of matter. The second is Einstein’s general theory of relativity that explains how gravity works, and is the basis for the so-called standard model of Big Bang cosmology. It is our best theory of space, time and the Universe.
     …  Richard Feynman might have been a poor philosopher, but he wasn’t joking when he wrote in 1965: ‘I think I can safely say that nobody understands quantum mechanics.’ To work satisfactorily, Big Bang cosmology requires rather a lot of ‘dark matter’ and ‘dark energy’, such that ‘what we can see’ accounts for an embarrassingly small 5 per cent of everything we believe there is in the Universe.
     …  We have no explanation for why the laws and constants of physics appear so ‘fine-tuned’
     …  Bringing them together in a putative theory of everything has proved to be astonishingly difficult. Despite much effort over the past 50 years, there is no real consensus on how this might be done
     …  In the absence of facts, what constitutes ‘the best explanation’?
     …  multiverse
     …  David Deutsch has declared that the multiverse is as real as the dinosaurs once were
     …  Sean Carroll, a vocal advocate for the Many-Worlds interpretation, prefers abduction, or what he calls ‘inference to the best explanation’
     …  Carroll .. Bayesian probability
     …  oxymoron that is post-empirical science
     …  Instead of ‘the multiverse exists’ and ‘it might be true’, is it really so difficult to say something like ‘the multiverse has some philosophical attractions, but it is highly speculative and controversial, and there is no evidence for it’? /19-10-16

    Driverless cars
     …  the limits of AI
     …  machine learning .. The more they drove, the more data they would collect, and the better they would become.
     …  reflexes operating at the speed of electronics would drastically improve safety
     …  a world of “zero crashes”
     …  And the technology was just around the corner. /19-10-11

    Olga Tokarczuk’s Novels Against Nationalism
     …  In the face of the Polish government’s rightist dogma, the country’s preëminent writer explores its history of ethnic intermingling.
     …  Olga Tokarczuk is fascinated by Poland’s long history of ethnic intermingling.
     …  Poles, Ukrainians, Lithuanians, Germans, Ruthenians, Jews—have lived side by side in a cacophony of languages and experience
     …  Poland, not unlike the United States, is politically split down the middle.
     …  who seek tolerance, multiculturalism, and a truthful reckoning with Poland’s past. These are Tokarczuk’s readers.
     …  history classes are limited to Polish history, narrated from a distinctly nationalist perspective
     …  Henryk Sienkiewicz, rather than its great nonconformists, such as Witold Gombrowicz and Bruno Schulz
     …  Tokarczuk was born in 1962, the first of two daughters, in a village just north of Lower Silesia. A small German minority had remained there
     …  Tokarczuk fell in love with the Kłodzko Valley
     …  psychotherapist of the past /19-10-11

    heaven, atheism and what gives life meaning
     …  The latest attack on religion by Richard Dawkins and Martin Hägglund’s argument for ‘secular faith’
     …  “Heaven: Will It Be Boring?” .. And not merely boring: utterly devoid of meaning. .. After all, there’s always tomorrow, and the next day, and the next.
     …  Religious people, even if they don’t believe in a literal place called heaven (“white bean bags, 24-hour room service, fat babies with wings”, to quote Alan Partridge), nonetheless believe that what truly matters most in life belongs to the realm of the eternal and divine.
     …  If our finite lives are all we have, it follows that time is the basis of all value
     …  Outgrowing God, Richard Dawkins
     …  his career in evolutionary biology might stand as an exemplar of the kind of life Hägglund urges us to live – a finite existence, devoted to the fragile and collaborative human endeavour of expanding scientific understanding. But atheism alone can’t explain why it should matter to spend your time that way. /19-10-09

    computer become my co-writer
     …  At the end of every section in this article, you can read the text that an artificial intelligence predicted would come next.
     …  Smart Compose, a feature that Google introduced, in May, 2018
     …  the idea for the product came in part from the writing of code—the language that software engineers use to program computers
     …  I was fascinated by the way the A.I. seemed to know what I was going to write.
     …  Sometimes the machine seemed to have a better idea than I did.
     …  making its discoveries available as open source—so long as it was safe to do so
     …  Brockman told me, a superintelligent machine would be of such immense value, with so much wealth accruing to any company that owned one, that it could “break capitalism” and potentially realign the world order. “We want to insure its benefits are distributed as widely as possible”
     …  the carbon footprint created by training a gigantic neural net is roughly equal to the lifetime emissions of five automobiles.
     …  Innovations in chip design, network architecture, and cloud-based resources are making the total available compute ten times larger each year
     …  Annals of Internal Medicine found Google Translate accurate enough to rely on in translating non-English medical studies into English for the systematic reviews that health-care decisions are based on.
     …  “The Future Will Not Be Supervised.” Supervised learning, which used to be the way neural nets were trained
     …  GPT (short for Generative Pretrained Transformer)
     …  “Until now, if you saw a piece of writing, it was like a certificate that a human was involved in it. Now it is no longer a certificate that an actual human is involved.”
     …  [Predicted Text:] If machines can learn to think for themselves, that might be a concern. But if we really want to replicate human intelligence—as most of us want to—there are several directions that researchers might explore.
     …  Experts can teach the machine .. Or engineers can design a machine that has the capacity to learn for itself .. its own rules
     …  added synthetic Pinker prose to the real thing, and asked people to guess where the author of “The Language Instinct” stopped and the machine took over.
     …  One can imagine a kind of Joycean superauthor, capable of any style, turning out spine-tingling suspense novels, massively researched biographies, and nuanced analyses of the Israeli-Palestinian conflict. Humans would stop writing, or at least publishing, because all the readers would be captivated by the machines. What then? GPT-2, prompted with that paragraph, predicted the next sentence: “In a way, the humans would be making progress.” /19-10-08

    Artificial Intelligence Generates Humans’ Faces Based on Their Voices
     …  In trials, the algorithm successfully pinpointed speakers’ gender, race and age
     …  learning .. with the help of millions of online clips capturing more than 100,000 different speakers
     …  Speech2Face
     …  associations between appearance and speech
     …  voice and “craniofacial features” such as nose structure
     …  high-pitched males, including children, were erroneously identified as females
     …  potential real-world application for Speech2Face is using the model to “attach a representative face” to phone calls on the basis of a speaker’s voice.
     …  recognize credit card customers calling the bank /19-10-07

    Prawdziwy ateista jest, myślę, rzadkim ptakiem. Tropi on w sobie pozostałości dawnych wierzeń i odrzuca jedne po drugich. Okazałą pozostałością jest niewyznana wiara w dobroczynne skutki ewolucji w Naturze i przedłużającej tę ewolucję historii ludzkiego gatunku. Wiara ta zakłada jakiś pakt przymierza, ten jednak, niestety, wymagałby dwóch kontrahentów, czyli ludzkości i siły opatrznościowej. Jeżeli po miliardach lat ewolucji człowiek pojawił się na ziemi mocą przypadkowych mutacji, jakiekolwiek przypisywanie wszechświatowi dobrych zamiarów wobec niego jest odmianą wyobrażeń religijnych. Innymi słowy, pomiędzy dziedziną wartości człowieka i niewzruszonymi prawami wszechświata brak najmniejszego związku (!!! aw) .. Nawet droga naukowcom pasja poszukiwania prawdy, zupełnie niewytłumaczalna (!!!), na niczym nie jest ugruntowana. /Czasław Miłosz/Ziemia Ulro str.257 wyd.2013/19-10-07

    machines are taking control of financial markets—not just the humdrum buying and selling of securities, but also the commanding heights of monitoring the economy and allocating capital. Funds run by computers that follow rules set by humans account for 35% of America’s stockmarket, 60% of institutional equity assets and 60% of trading activity. New artificial-intelligence programs are also writing their own investing rules, in ways their human masters only partly understand. Industries from pizza-delivery to Hollywood are being changed by technology, but finance is unique because it can exert voting power over firms, redistribute wealth and cause mayhem in the economy. /Zanny Minton Beddoes/The Economnist/19-10-07

    Populists under pressure
     …  After a series of reverses, they are down, but certainly not out
     …  Salvini is out of Italy’s government
     …  in Hungary, Viktor Orban’s populist ruling party faces the threat of losing control of the country’s capital
     …  Austria’s, has come to grief at the ballot box /19-10-07

    Roger Penrose Why Consciousness Does Not Compute
     …  controversial theory of mind
     …  Penrose, 85 .. twistor theory .. tiles .. Fashion, Faith and Fantasy in the New Physics of the Universe—a dense 500-page tome
     …  Most scientists regard quantum mechanics as irrelevant to our understanding of how the brain works.
     …  Even if the human brain’s neurons, synapses and neurotransmitters could be completely mapped—which would be one of the great triumphs in the history of science—it’s not clear that we’d be any closer to explaining how this 3-pound mass of wet tissue generates the immaterial world of our thoughts and feelings.
     …  David Chalmers has speculated that consciousness may be a fundamental property of nature existing outside the known laws of physics.
     …  “mysterians”—claim that subjective experience is simply beyond the capacity of science to explain
     …  Penrose’s theory .. We need a major revolution in our understanding of the physical world in order to accommodate consciousness
     …  making sense of quantum mechanics
     …  Hameroff’s idea that quantum coherence happens in microtubules
     …  Penrose-Hameroff theory of Orchestrated Objective Reduction, known as Orch-OR
     …  quantum gravity
     …  As Smolin has said, “All Roger’s thoughts are connected ... twistor theory, his philosophical thinking, his ideas about quantum mechanics, his ideas about the brain and the mind.”
     …  Most scientists believe the brain is too warm and wet for quantum states .. Max Tegmark .. so I’d need to be able to think fast enough to have 10,000,000,000,000 thoughts each second .. Perhaps Roger Penrose can think that fast
     …  Even Penrose’s old collaborator Stephen Hawking is dubious. “I get uneasy when people, especially theoretical physicists, talk about consciousness,” he’s written. “His argument seemed to be that consciousness is a mystery and quantum gravity is another mystery so they must be related.”
     …  Penrose .. his interest in consciousness goes back to his discovery of Gödel’s incompleteness theorem .. “This, to me, was an absolutely stunning revelation,” he said. “It told me that whatever is going on in our understanding is not computational.”
     …  Minsky’s claims compelled Penrose to write The Emperor’s New Mind, arguing that human thinking will never be emulated by a machine.
     …  Hameroff .. spiritual views, talking openly about the possibility of the soul existing after death. Penrose is an atheist who calls himself “a very materialistic and physicalist kind of person”
     …  Schrödinger’s cat .. “An element of proto-consciousness takes place whenever a decision is made in the universe,” .. Is it a choice made by the universe? .. Maybe it’s a free choice. I have no idea.
     …  Many neuroscientists believe decisions are caused by neural processes that aren’t ruled by conscious thought, rendering the whole idea of free will obsolete.
     …  indeterminacy that’s intrinsic to quantum theory .. Is Penrose making the case for free will? .. choices would be random. But free will, is that random?
     …  It’s a kind of delicate borderline between completely deterministic behavior and something which is completely free.
     …  Purpose—what does that mean? /19-10-07

    Alexis de Tocqueville (1805-1859)
    Demokracja kończy się wtedy, kiedy rząd zauważy, że może przekupić ludzi za ich własne pieniądze. /PAUza/Jan Woleński/19-10-05

    Consciousness Doesn’t Depend on Language
     …  Buddhist monk-scholars and Western scientists
     …  Cultural mores change slowly, and early childhood religious imprinting is powerful.
     …  Modernity abandoned the belief in a Cartesian soul, but the dominant cultural narrative remains—humans are special
     …  the architecture of the nervous system is remarkably conserved across all mammals
     …  we see a myriad of quantitative but no qualitative differences between the brains of mice, dogs, monkeys, and people
     …  The receptors and pathways that mediate pain are analogous across species.
     …  The most obvious trait that distinguishes humans from other animals is language.
     …  classical scholars assign to language the role of kingmaker when it comes to consciousness
     …  The belief that only humans experience anything is preposterous, a remnant of an atavistic desire.
     …  split-brain patients .. corpus callosum has been surgically cut .. Almost half a century of research demonstrates that these patients have two conscious minds.
     …  a knowledge that our life has a finite horizon, the worm at the core of human existence. Death has no such dominion over animals.
     …  we share the experience of life with all mammals. /19-10-02

    consciousness
     …  Self-replicating, bacterial life first appeared on Earth about 4 billion years ago. For most of Earth’s history, life remained at the single-celled level, and nothing like a nervous system existed until around 600 or 700 million years ago.
     …  In the attention schema theory, consciousness depends on the nervous system processing information in a specific way.
     …  Hydras work on nerve-net principle .. A nerve net doesn’t process information—not in any meaningful sense. It merely transmits signals around the body.
     …  After the emergence of the nerve net, however, nervous systems rapidly evolved a second level of complexity: the ability to enhance some signals over others. This simple but powerful trick of signal boosting is one of the basic ways that neurons manipulate information. It is a building block of almost all computations that we know about in the brain.
     …  The eye of the crab is one of the best-studied examples. The crab has a compound eye with an array of detectors, each with a neuron inside it. If light falls on one detector, it activates the neuron inside. So far so good. But in an added pinch of complexity, each neuron is connected to its nearest neighbors, and because of those connections, the neurons compete with each other. When a neuron in one detector becomes active, it tends to suppress the activity of the neurons in the neighboring detectors, like a person in a crowd who is trying to shout the loudest while shushing the people nearest to him. The mechanism in the eye of a crab is arguably the simplest and most fundamental example of attention. Our human attention is merely an elaborated version of it, made of the same building blocks.
     …  The origin of attention lies deep in evolutionary time, more than half a billion years ago, with a surprisingly simple innovation.
     …  each part of the body would function like a separate device, filtering its own information and picking out the most salient signals
     …  The animal’s behavior would be, at best, chaotic. For a coherent response to its environment, the animal needs a more centralized attention.
     …  Nobody knows when that type of centralized attention first appeared
     …  Octopuses are the superstars of the invertebrates because of their astonishing intelligence.
     …  No other intelligent animal is as far from us on the tree of life.
     …  big-brained smartness is not a one-off event, because it evolved independently at least twice—first among the vertebrates and then again among the invertebrates.
     …  It can use tools, solve problems, and show unexpected creativity.
     …  a central brain and also an independent, smaller processor in each arm, giving it a unique mixture of centralized and distributed command.
     …  probably has self models .. In that sense, you could say that an octopus knows about itself.
     …  do not mean that an octopus is conscious.
     …  Consciousness could be irrelevant to the animal.
     …  People sometimes believe that their houseplants are conscious. /19-10-01

    Dariusz Stola, the director of the Polin Museum, in Warsaw, which Poland’s nationalist-conservative government has seized control of as part of its efforts to legislate the country’s memory.
     …  What Stola characterized as the “marginal left” said that Polin did not sufficiently highlight the history of anti-Semitism in Poland; the “marginal right,” on the other hand, wanted more information on Poles who helped Jews escape or hide from the Nazis during the Second World War. “They both wanted more non-Jews,” Stola joked.
     …  “Stola has done a surprisingly good job,” Konstanty Gebert, a prominent Jewish journalist and activist in Warsaw, told me. “That guy has been the most brilliant museum director,” Kirshenblatt-Gimblett said. “He is a terrific scholar. He is a great guy. He is a mensch of the first order.”
     …  Miracles have a way of ending. In 2015, Poland elected a nationalist-conservative government, which, like many other Eastern and Central European governments, promised to make the country’s past great again; “Down with the pedagogy of shame” was one of its buzz phrases.
     …  The legislation of memory is not in itself unfamiliar. All European countries do it.
     …  xenophobic and anti-Semitic statements from 1968 and 2018
     …  Piotr Gliński, had to formally reappoint Stola. He has not.
     …  Stola told me that he has also clocked two thousand kilometers on his bicycles during his forced vacation, but that, as is his way, he remains full of hope. /The New Yorker/19-09-25

    Quantum computer bests all conventional computers in first claim of ‘supremacy’
     …  internet leak
     …  physicists at Google have used a quantum computer to perform a calculation that would overwhelm the world’s best conventional supercomputer
     …  a milestone known as “quantum supremacy”
     …  power comes from other quantum phenomena .. waves interfere
     …  factoring the huge numbers
     …  53 qubits
     …  pairs of qubits interact in various ways through a fixed but random set of operations
     …  uneven distribution of outputs
     …  quantum device calculated something
     …  What the quantum computer could do in a little over 3 minutes would take a supercomputer 10,000 years to reproduce, they estimate.
     …  isn’t so much a computation as an effort to cook up a quantum state that’s hard to simulate
     …  no practical applications
     …  The Google computer also lacks the ability to correct errors
     …  to maintain quantum states much longer
     …  We are only one creative algorithm away from valuable near-term applications /19-09-25

    Hugh Everett .. quantum mechanics .. Many-Worlds .. 1950s by Sean Carroll
     …  Copenhagen Interpretation .. It was never a satisfying set of ideas, but Bohr’s personal charisma
     …  wave function .. But when we do look at them .. collapsing
     …  What exactly counts as a measurement? And what makes observers so special?
     …  The world has ‘branched’ .. they can’t interact with each other; what happens in one branch has no effect on what happens in the other.
     …  Everett .. ‘The Copenhagen Interpretation is hopelessly incomplete because of its a priori reliance on classical physics ... as well as a philosophic monstrosity with a “reality” concept for the macroscopic world and denial of the same for the microcosm’
     …  Consciousness, in particular, has nothing to do with it. The ‘observer’ could be an earthworm, a microscope or a rock.
     …  The price we pay for such a powerful and simple unification of quantum dynamics is a large number of separate worlds.
     …  Everett died in 1982, aged 51, of a sudden heart attack.
     …  Everett’s ideas are more relevant than ever.
     …  how to reconcile gravity with quantum theory
     …  it doesn’t make much sense to carve out a special place for a classical observer
     …  start from a purely quantum wave function, and ask whether we can pinpoint individual ‘worlds’ within it that look like the curved spacetime of general relativity
     …  Don’t quantise gravity; find gravity within quantum mechanics. /19-09-23

    Exoplanet K2-18b .. 110 light-years
     …  8.6 times the mass .. mini-Neptune
     …  liquid droplets of H2O
     …  orbits a red dwarf .. much closer
     …  to discovering a world like our own. /19-09-18

    Olga Tokarczuk the longlists for the 2019 National Book Awards
     …  a talented redescriber of the world
     …  relishes her role as a challenger of orthodoxies
     …  "Drive Your Plow Over the Bones of the Dead" Translated by Antonia Lloyd-Jones, Riverhead Books / Penguin Random House /19-09-17

    Neanderthals vanished from Earth about 40,000 years ago.
     …  new explanation .. unusually prone to severe ear infections
     …  skulls .. Eustachian tube was horizontal
     …  hearing problems then they would have had more trouble communicating and hunting /19-09-16

    maths corresponds to the Universe Galileo and Emmy Noether
     …  mathematics expresses perfectly the behaviour of the physical world
     …  So why is mathematics so effective in distilling the essence of the world?
     …  Graham Farmelo .. The Universe Speaks in Numbers
     …  Einstein’s theory of gravity—was not any experimental result or observation, but the requirement of mathematical consistency
     …  “mathematical symmetries” in the Universe was recognised in 1918 by the German mathematician Emmy Noether
     …  String theory .. unifies both quantum theory and special relativity .. 10 dimensions of space-time
     …  String theory is the ultimate embodiment of Galileo’s idea that mathematics is the language of nature.
     …  Wolfram .. mathematics illuminates only the bits of the Universe that mathematics is able to illuminate
     …  22nd century, we will obtain better tools .. most of what the Universe is doing is not mathematical
     …  mathematics-physics connection is a two-way street
     …  the central mystery of the unreasonable effectiveness of mathematics remains a mystery
     …  collecting data from experiments and by discovering the mathematics /19-09-14

    the End of Democracy
     …  Lisbon .. International Society of Political Psychologists’ annual meeting
     …  papers on everything from the explosion in conspiracy theories to the rise of authoritarianism
     …  Shawn Rosenberg .. challenging a core assumption about America and the West .. Democracy is devouring itself—his phrase — and it won’t last.
     …  “we the people”
     …  “elites”-experts and public figures
     …  democratic governance will continue its inexorable decline and will eventually fail
     …  The last half of the 20th century was the golden age of democracy. In 1945 .. there were just 12 democracies in the entire world. By the end of the century there were 87.
     …  Right-wing populist .. in Poland, Hungary, France, Britain, Italy, Brazil and the United States.
     …  Democracy is hard work and requires a lot from those who participate in it.
     …  It requires thoughtfulness, discipline and logic.
     …  Unfortunately, evolution did not favor the exercise of these qualities
     …  Our brains, says Rosenberg, are proving fatal to modern democracy. Humans just aren’t built for it.
     …  When people are left to make political decisions on their own they drift toward the simple solutions right-wing populists worldwide offer: a deadly mix of xenophobia, racism and authoritarianism.
     …  senators, journalists, professors, judges .. elites .. helped the populace understand the importance democratic values. But today that is changing. Thanks to social media and new technologies, anyone with access to the Internet can publish a blog
     …  today fewer and fewer citizens take the elites seriously
     …  Living in a news bubble of their own making many undoubtedly believed it.
     …  Forget political correctness. You can feel exactly the way you really want about people who belong to other tribes.
     …  psychological research shows everybody’s irrational, professors included! /19-09-11

    Truth in Physics a truly fundamental understanding of the world
     …  Physics seems to be one of the only domains of human life where truth is clear-cut .. mathematical rigor and experimental proof .. answers, not endless muddle
     …  Physics does not dictate how we run our lives or resolve pressing moral dilemmas, but it sets the backdrop against which we decide these questions.
     …  Quantum mechanics is as well tested a theory as can be, yet its interpretation remains inscrutable.
     …  realism .. entities we do not directly observe but infer theoretically—such as atoms, particles, and space and time—really do exist
     …  the photon does what it does for no reason at all; the randomness is intrinsic
     …  Additional parallel universes could exist in higher dimensions of space beyond our view. .. There is not a single definite reality.
     …  We necessarily live in a universe that can support human life, so our measurements of the cosmos might not be fully representative.
     …  The combination of quantum mechanics with relativity theory rules out particles: according to several mathematical theorems, nothing can be localized in the way that the traditional concept of a particle implies.
     …  hard-to-interpret mathematical abstraction
     …  if multiple mathematical formulations are equivalent, how do we know which, if any, corresponds to reality?
     …  Many critics of string theory complain that no known instrument can test it because it involves such minuscule effects.
     …  unification
     …  The deeper physicists dive into reality, the more reality seems to evaporate.
     …  no nouns will be left at all .. the entire category of “thing” is misguided
     …  Our inner mental life is hidden from external observation and does not seem reducible to mathematical description.
     …  Immanuel Kant argued that the structure of our minds conditions what we perceive.
     …  In machine learning, researchers have found that computer systems are often better at making predictions or controlling equipment when they eschew direct representations of the world.
     …  Steven Pinker have suggested that our particular style of reasoning is why we find consciousness so hard
     …  Perhaps one day we will construct artificial minds that see right through the problems that stump us, although they might get hung up on those we think are easy.
     …  even if we worry that we aren't experiencing the fundamental reality, we are still experiencing our reality, and there's plenty to study there. /19-09-01

    A Market Correction in the Humanities .. liberal arts school and art school closings
     …  Seemingly in decline since Socrates was forced to drink hemlock for corrupting the youth of Athens
     …  “culture wars” of the 1980 and ’90s .. humanistic disciplines regularly degraded .. as .. performative nonsense and grotesquerie undertaken by overly entitled women, queers, and people of color
     …  Now we have a different .. liberal arts schools, are not cost-effective
     …  no corporation has anything like the “priceless” form of value that a Comparative Literature department offers
     …  universities .. They would no longer be places to fund but to invest in
     …  cannot be valued or priced by any consistent metric
     …  they actually make money for the university because they cost so little to administer
     …  be closing. (“Seeking to partner” with another institution was the choice idiom.)
     …  humanities scholars would benefit from being less sentimental about the reasons for the Keynesian state’s success
     …  continuing-education initiatives, community colleges, and so on /19-09-01

    Beyond “p<0.05”
     …  researchers are free to treat “p = 0.051” and “p = 0.049” as not being categorically different
     …  As “statistical significance” is used less, statistical thinking will be used more.
     …  Don’t Say “Statistically Significant”
     …  Similarly, we need to stop using confidence intervals as another means of dichotomizing
     …  Where p-values are used, they should be reported as continuous quantities (e.g., p = 0.08).
     …  the real significance of statistics, which is “the science of learning from data, and of measuring, controlling, and communicating uncertainty”
     …  “Accept uncertainty. Be thoughtful, open, and modest.” Remember “ATOM.”
     …  to avoid dealing with uncertainty by escaping to a “happy place” where results are either statistically significant or not. In the real world, data provide a noisy signal.
     …  Statistics .. is often sold as a sort of alchemy that transmutes randomness into certainty
     …  The null hypothesis from which an SGPV is computed is a composite hypothesis representing a range of differences that would be practically or scientifically inconsequential
     …  anything goes, and then answer affirmatively: “Everything should be published in some form if whatever we measured made sense before we obtained the data because it was connected in a potentially useful way to some research question” /19-08-29

    Reason The Enigma of Reason
     …  Reason developed not to enable us to solve abstract, logical problems or even to help us draw conclusions from unfamiliar data; rather, it developed to resolve the problems posed by living in collaborative groups.
     …  Habits of mind that seem weird or goofy or just plain dumb from an “intellectualist” point of view prove shrewd when seen from a social “interactionist” perspective.
     …  confirmation bias .. Those who’d started out pro-capital punishment were now even more in favor of it; those who’d opposed it were even more hostile.
     …  adaptive function .. related to our “hypersociability”
     …  myside bias
     …  reason evolved to perform, which is to prevent us from getting screwed by the other members of our group
     …  small bands of hunter-gatherers .. There was little advantage in reasoning clearly, while much was to be gained from winning arguments.
     …  environment changed too quickly for natural selection to catch up
     …  “The Knowledge Illusion: Why We Never Think Alone”
     …  Providing people with accurate information doesn’t seem to help; they simply discount it. Appealing to their emotions may work better /19-08-28

    human vision
     …  A lot of the things you think you see you’re actually making up
     …  mathematics is the key .. neuroscientist
     …  there’s very little connectivity between the retina and the visual cortex
     …  LGN, or lateral geniculate nucleus, the only pathway through which visual information travels from the outside world into the brain
     …  LGN cells send a pulse to the visual cortex when they detect a change
     …  the brain doesn’t take a picture, the retina does
     …  For every 10 LGN neurons that snake back from the retina, there are 4,000 neurons in just the initial “input layer” of the visual cortex
     …  the brain heavily processes the little visual data it does receive
     …  The visual cortex has a mind of its own
     …  If you watch a single neuron’s membrane potential, it’s fluctuating wildly up and down. There’s no way to tell exactly when it’s going to fire.
     …  butterfly effect .. recurrent excitation
     …  While their model is far from uncovering the full mystery of vision, it is a step in the right direction — the first model to try and decipher vision in a biologically plausible way. /19-08-28

    sacrifice our lives to save a billion strangers
     …  2,000 votes: 12 percent would sacrifice their life for one stranger, 31 percent for a thousand strangers, 21 percent for a million strangers, and 35 percent for a billion strangers
     …  Christakis .. Blueprint: The Evolutionary Origins of a Good Society
     …  philosophical point about the fundamental goodness of humanity
     …  the exact same aspirations at the end of life: to make amends for mistakes, to be close to loved ones, to tell one’s story to someone who will listen, and to die free of pain”
     …  we need to find new ways to appeal to the better angels of our nature
     …  gene-culture co-evolution
     …  It’s an evolutionary luxury to be a unique person. Every human face is different. Why don’t we all have the same face? Well, it’s crucial to living socially.
     …  The literature on group mixing is complicated and often depressing.
     …  What’s more valuable, an unrecognized, simple life that’s long on the planet, or a glorious, widely recognized, but short life?
     …  Steven Pinker and others have argued, that the Enlightenment fostered the emergence of a good life /19-08-26

    emotions are the deep engine of human consciousness and the basis of our profound affinity with other animals
     …  Darwin .. The Expression of Emotions in Man and Animals (1872)
     …  Even morality, he argued, arose through natural selection.
     …  Martha Nussbaum began to reintroduce emotion as a form of pseudo-judgment
     …  emotions as biological adaptations
     …  Are emotions truly universal?
     …  repeatable constraints or influences on perception come mostly from feelings, emotions or affects, not language, beliefs or concepts
     …  On a constructionist view I, or my culture, could decide to define fear as happiness
     …  amygdala
     …  absurd consequence of the constructionist view of emotion when it comes to the lives of nonhuman animals
     …  In our book The Emotional Mind: The Affective Roots of Culture and Cognition (2019), we argue that emotional systems are central to understanding the evolution of the human mind (as well as those of our primate cousins).
     …  For at least 200 million years, the emotional brain has been under construction.
     …  The seven emotions are universal in humans and mammals but are filtered through the three layers of mind
     …  FEAR, LUST, CARE, PLAY, RAGE, SEEKING and PANIC/GRIEF .. Jaak Panksepp
     …  primary and secondary emotions have phenomenal consciousness
     …  Meaning is foundationally a product of embodiment, our relation to the immediate environment, and the emotional cues of social interaction, not abstract correspondence between sign and referent.
     …  it can enable a more accurate, robust understanding of our needs, desires and motivations into the future. /19-08-25

    Realism …again
     …  realism seems to be our default position
     …  antirealism resulted from certain unintended consequences of the Enlightenment
     …  Friedrich Nietzsche concluded that the view of the world presented by Enlightenment science left no room for objective morality
     …  every form of knowledge should be viewed with suspicion, as an expression of some sort of power .. Michel Foucault, Jacques Derrida, and Richard Rorty
     …  Vladimir Putin, Silvio Berlusconi, and Donald J. Trump have all profited from the collapse of a broad cultural consensus about what is plausibly true
     …  reality and truth have always constituted the protection of the weak against the oppression of the strong
     …  Descartes .. Once that “inside/outside” structure was accepted, there would always be the problem of how to get outside one’s head to compare one’s ideas to the real world.
     …  the appearance that we are subconsciously interacting with an external world may be just another aspect of our illusory inner representations
     …  Perhaps the most significant fault line among the competing options is marked out by the question of what, at bottom, the building blocks of reality are. Given that there is a reality out there, what is it made of?
     …  Naturalism, Observable and Measurable
     …  naturalism is far more popular than any other competing view in analytic philosophy .. physics and chemistry—and is preferred even in the softer ones—biology, psychology, sociology
     …  Reality is scientific
     …  reality .. is hierarchically structured. Coming first are fundamental physical entities
     …  no need of teleology .. It seemed clear that reality would be explained through observation, not through an appeal to an embedded orientation to the Good.
     …  Because naturalism holds that everything real must ultimately trace its roots to what science can describe, the reality of certain other things becomes doubtful. These things include consciousness, value, morality, meaning, teleology, reason, intentionality, free will, life, the soul, and the self.
     …  rather than “spooky,” I will call these phenomena by an older term for denoting the distinctively human: humanitas.
     …  the neural corelates of consciousness
     …  Alexander Rosenberg .. The Atheist’s Guide to Reality .. humanitas is illusory
     …  In slogan form: Science can’t explain everything .. not being a naturalist is to think God exists
     …  fine-tuning .. multiverse
     …  Thomas Nagel .. Mind and Cosmos .. pressure on otherwise random arrangements of molecules .. “Reality wants conscious life to exist.” Deeply puzzling, if not incoherent.
     …  secular theism /19-08-21

    The language of mind David Chalmers
     …  We’ve got these bodies and these brains, which work okay, but we also have minds .. we’re conscious .. we all experience ourselves as having a mind .. is pretty central to our conception of ourselves .. some neural and computational mechanisms
     …  explaining the mind .. leaves an explanatory gap .. a subjective experience .. the hard problem of consciousness, as opposed to, say, the easy problems of explaining behavior.
     …  Could you explain conscious experience in terms of the brain? Does it require something fundamentally new? Does it exist at all?
     …  the meta-problem of consciousness .. why we think there is a problem of consciousness
     …  hat’s going on in us so that it might have some applicability to AI as well
     …  "artificial consciousness" .. but the whole question of criteria is very difficult .. operational criteria .. "I know on principle I’m just a bunch of silicon circuits, but from the first-person perspective, I feel like so much more"
     …  modeling the world and not bringing itself into the equation
     …  introspective self-models
     …  The next step is whether an AI of this kind is going to naturally experience consciousness as somehow puzzling, as something that potentially is hard to square with basic underlying mechanisms and hard to explain.
     …  a little theorem prover, a little software agent .. to look at with the help of our friends from psychology, neuroscience, and philosophy.
     …  You’ll thereby have explained the illusion and explained away the problem of consciousness.
     …  information integration theories
     …  the reports can disassociate from the information integration in various, interesting ways /19-08-14

    nature vs. nurture
     …  Dialogue between the natural and social sciences should have fostered a golden age for the study of human behavior.
     …  how to explain differences between individuals and groups are more controversial than ever—perhaps not surprisingly, given the political implications of any answer
     …  Genetic modification technologies are moving faster than the ethical frameworks
     …  gene-edited babies
     …  why humans are different
     …  why we are .. so very similar
     …  the science underlying who we are
     …  genetics are a fortune teller, indicating our fate if we have the knowledge to “read” them
     …  whether “it” (the fundamental explanatory factor for who we are and how we differ) is “all in our genes”
     …  predestination thesis
     …  humans might be getting smarter because of urbanization
     …  It is possible to believe that genes do the heavy lifting with regard to why humans are different while acknowledging that history and context profoundly influence how society is structured.
     …  it is possible to believe that genes do a lot of the heavy lifting with regard to why humans are different—physically, physiologically, psychologically—while fully acknowledging that history and context can profoundly influence how society is structured.
     …  without a reflexive value judgement on which ones are “better.” /19-08-13

    Exoplanet Survey
     …  73 light-years away
     …  TOI-270
     …  why do planets form in the sizes they do? How does the solar system fit into a wider galactic context? And, is there life beyond Earth?
     …  TESS .. it has found 24 planets the existence of which has been confirmed by other means, and a further 1,000 possibles that are waiting to be checked.
     …  “Fulton gap” .. lots of super-Earths and lots of mini-Neptunes. But there is a gap between them
     …  photoevaporation hypothesis
     …  ultraviolet light falling on the early Earth provided the energy needed to make the complex organic molecules that were life’s precursors
     …  how propitious are astronomical circumstances for the development of life?
     …  how many Earthlike worlds exist in the galaxy
     …  “If we find these alien Edens” /19-08-13

    Olga Tokarczuk’s Novels Against Nationalism
     …  In the face of the Polish government’s rightist dogma, the country’s preëminent writer explores its history of ethnic intermingling.
     …  Olga Tokarczuk is fascinated by Poland’s long history of ethnic intermingling.
     …  a contender for the Nobel Prize in Literature
     …  Tokarczuk, who is fifty-seven, is petite and striking, with the focussed energy of a yoga teacher.
     …  Poland, not unlike the United States, is politically split down the middle.
     …  Zofia Król, the editor of the online literary magazine Dwutygodnik
     …  history classes are limited to Polish history, narrated from a distinctly nationalist perspective; literature classes emphasize classics of Polish literature, such as the historical novels of Henryk Sienkiewicz, rather than its great nonconformists, such as Witold Gombrowicz and Bruno Schulz.
     …  Tokarczuk has been toying with the idea of living more or less full time in her country house in the Kłodzko Valley,
     …  “Flights,” “Bieguni” (“Runners”)
     …  “Every culture is built upon defense mechanisms” /The New Yorker/August 5 & 12 2019/19-08-11

    Something, Rather Than Nothing, Sean M. Carroll
     …  Leibniz .. “Why is there something rather than nothing?” .. Principle of Sufficient Reason (“nothing is without a ground or reason why it is”)
     …  God is the reason the universe exists, but God’s existence is its own reason, since God exists necessarily.
     …  Kant [9] doubted that the intellectual tools we have developed to understand the world of experience could sensibly be extended to an explanation for existence itself.
     …  What Does “Why” Mean?
     …  why a glass falls to the floor or why do fools fall in love
     …  Perhaps the concept of “nothingness” is incoherent
     …  Reality itself simply exists, in the way that it does, without further explanation.
     …  Due to the phenomenon of spontaneous symmetry breaking, the most symmetric vacuum (in which the expectation value of all the quantum fields vanishes) is generally not the true vacuum.
     …  there is something rather than nothing because “nothing is unstable” .. This has nothing at all to do with the origin of the universe itself
     …  creation of something from nothing .. “quantum fluctuations”
     …  A quantum state is simply a quantum state, and a true vacuum state will be stationary, with nothing “fluctuating” at all.
     …  The situation diverges from our Newtonian intuition even more dramatically when we turn to quantum gravity
     …  the distinction between “empty space” and “space filled with stuff” is blurred, practically to invisibility
     …  An intriguing modern idea is that spacetime itself can be defined in terms of the entanglement between a set of abstract quantum degrees of freedom.
     …  The best we can say is that our current incomplete understanding of quantum gravity is fully compatible with both the possibility that the universe has lasted forever, and that it had a first moment in time.
     …  If the Wheeler-DeWitt equation is correct, it presents us with an immediate challenge, known as the “problem of time”: there is no time parameter in the equation, so what is “time” supposed to mean?
     …  time might be emergent, rather than fundamental
     …  conservation of energy .. If the energy is nonzero, therefore, it follows that time must extend in both directions – the energy must “go somewhere” in time.
     …  a non-existent universe has the same energy (zero) as an existent one obeying the Wheeler-DeWitt equation – and which can therefore have a beginning
     …  differential equations might describe what the universe does, but they don’t explain the reason why
     …  demand that such an explanation must exist.
     …  to exist is more perfect than to not exist .. the notion of “perfection” is not rigorously defined
     …  Hume emphasized, there is no being whose non-existence would entail a logical contradiction
     …  Our idea of satisfying explanations has, needless to say, been trained on our experience within a tiny fraction of reality, not on the existence of the whole of reality itself; but we work with what we have.
     …  search for evidence for such an extra-universal entity .. But there is no logical or empirical reason why such an entity must exist; the universe can just be.
     …  Einstein .. “What really interests me is whether God had any choice in the creation of the world” .. this ambition seems hopeless
     …  There are an infinite number of selfconsistent quantum-mechanical systems that are different from our actual universe. .. different sets of eigenvalues for the Hamiltonian
     …  ways the laws of physics could have been that aren’t quantum-mechanical at all
     …  distinction one might draw between “conceivable” and “possible” .. logical consistency or agreement with the laws of nature. Neither of these criteria is relevant here (any Hamiltonian leads to logically consistent laws of physics, and the laws of nature are precisely what are being decided upon).
     …  the universe and its laws of nature are the simplest that they could be, given that they also satisfy some other condition – something as specific as describing a quantum-mechanical four-dimensional spacetime with local laws of physics, or something as broad as the existence of intelligent observers.
     …  (to be specified) sense maximally elegant
     …  Many observed features of both fundamental physics and cosmology seem to be arbitrary, from the large-scale structure of stars and galaxies to the masses of elementary particles. Many physicists now suspect that the laws of physics in our observable universe are just one possibility among a very large “landscape” of physically realizable possibilities, known as “vacua” (since they are local minimum-energy states), each of which features different particles, forces, couplings, and even numbers of spatial dimensions. In string theory, estimates for the size of this landscape throw around numbers of the form 10500.
     …  anthropic principle
     …  low entropy of the early universe, which is many orders of magnitude smaller than what it would need to be in order for life to existt. More generally, the universe simply seems to have far more stuff in it than any reasonable anthropic criterion would imply; there are more than a trillion galaxies, with of order a hundred billion stars and planets in each of them, none of which is necessary for our existence here.
     …  why wouldn’t it take the form of a relatively small collection of atoms in otherwise empty space .. our universe doesn’t look as minimal as it possibly could
     …  the properties of our particular universe cannot be solely attributed to the fact that intelligent observers exist within it, even if some particular properties may be.
     …  Surely the most natural state of affairs is simply nothing.” “Natural” presumably isn’t the right idea in this context; by definition, whatever reality is, it’s natural.
     …  it is sometimes suggested that the regularities we label “laws of nature” are inexplicable in the absence of some entity that ensures those laws are obeyed
     …  Ideas that become ingrained from our experience with the everyday world may not extend
     …  we are left to explain the existence of a creator .. creator explains its own existence, but then we can ask why the universe couldn’t have done the same thing
     …  “multiverse” to refer to something that is actually more prosaic than it sounds: a single connected spacetime, but with regions (“universes”) where conditions are very different from each other.
     …  In other contexts .. Everettian quantum mechanics
     …  something a bit more grandiose: a collection of truly distinct realities (noninteracting, not stemming from a common past, not necessarily with the same laws of physics), one of which is our own.
     …  metaverse .. trying to explain the existence of multiple realities rather than just one.
     …  the idea that “nothing exists” might not, despite the seeming naturalness of the formulation, actually be a coherent idea
     …  perhaps the universe exists simply because there was no coherent alternative.
     …  brute facts that are in some sense completely arbitrary
     …  We are always welcome to look for deeper meanings and explanations. What we can’t do is demand of the universe that there be something we humans would recognize as a satisfactory reason for its existence. /19-07-26

    the myth of freedom Yuval Noah Harari
     …  Governments and corporations will soon know you better than you know yourself. Belief in the idea of ‘free will’ has become dangerous
     …  the liberal story is flawed, that it does not tell the truth about humanity .. we need to go beyond it
     …  religious and nationalist fanatics who believe in nostalgic fantasies
     …  the future of our species.
     …  liberalism can reinvent itself yet again .. the main challenge it faces today .. not even from the demagogues and autocrats that are spreading everywhere like frogs after the rains .. emerges from the laboratories
     …  Liberalism is founded on the belief in human liberty.
     …  “free will”
     …  the voter knows best .. the customer is always right
     …  Unfortunately, “free will” isn’t a scientific reality. It is a myth inherited from Christian theology.
     …  our eternal souls, which are independent of all physical and biological constraints
     …  Humans certainly have a will – but it isn’t free. You cannot decide what desires you have.
     …  Every choice depends on a lot of biological, social and personal conditions that you cannot determine for yourself.
     …  by my genes, my biochemistry, my gender, my family background, my national culture, etc
     …  now the belief in “free will” suddenly becomes dangerous
     …  the easiest people to manipulate will be those who believe in free will
     …  not need to know you perfectly. That is impossible. .. to know you a little better than you know yourself.
     …  When Hitler gave a speech on the radio, he aimed at the lowest common denominator, because he couldn’t tailor his message to the unique weaknesses of individual brains.
     …  In recent years some of the smartest people in the world have worked on hacking the human brain in order to make you click on ads and sell you stuff.
     …  At present, the hackers rely on analysing signals and actions in the outside world: the products you buy, the places you visit, the words you search for online. Yet within a few years biometric sensors could give hackers direct access to your inner world, and they could observe what’s going on inside your heart.
     …  correlate your heart rate with your credit card data, and your blood pressure with your search history.
     …  “know thyself”. Yet in the days of Socrates, the Buddha and Confucius, you didn’t have real competition.
     …  antivirus for the brain
     …  Ancient problems of philosophy are now becoming practical problems of engineering and politics.
     …  inconclusively for 3,000 years – engineers are far less patient
     …  your amygdala might be working for Putin, and that the next thought that emerges in your mind might well be the result of some algorithm that knows you better than you know yourself? These are the most interesting questions humanity now faces.
     …  Instead of confronting the challenge of AI and bioengineering, many are turning to religious and nationalist fantasies that are even less in touch with the scientific realities of our time than liberalism.
     …  veracity of the Bible and the sanctity of the nation (especially if you happen, like me, to live in a place like Israel).
     …  Autocrats who plan to rule in perpetuity don’t like to encourage the birth of ideas that might displace them. But liberal democracies inspire the creation of new visions, even at the price of questioning their own foundations. /19-07-22

    advance in artificial intelligence is so rapid
     …  Will the robots of the future surpass and then subordinate their creators?
     …  expected .. as soon as 2045
     …  existing AI systems have a narrow remit
     …  Machine learning-trained algorithms now outperform human specialists across a range of applications. But artificial general intelligence (AGI)
     …  Specific AIs will be hard enough to handle, creating “vast new opportunities and risks worthy of careful attention in their own right”. If you integrate enough specific AIs into a single interface
     …  Engineers are busy translating existing rules and norms into the rigid terminologies of code.
     …  “learning apprentice” or “human-in-the-loop” systems
     …  New software is superseding some jobs but creating others – and not the menial repetition of the production line, which robots now handle, but innovative, constructive, meaningful activity, shaping and refining the human artifice.
     …  It was not the appropriation of humanity by robots but the dehumanisation of people that caused greater concern to 20th-century
     …  AI systems will augment rather than diminish our humanity /19-07-22

    Anna Świrszczyńska

    Zachcianka

    Istniejąc
    chciałabym na mgnienie oka
    doznać
    nieistnienia.

    Kiedy przestanę istnieć,
    będzie to już
    niemożliwe.


    Czternastoletnia sanitariuszka myśli zasypiając

    Żeby wszystkie kule na świecie
    trafiły we mnie,
    toby już nie mogły trafić w nikogo.

    I żebym umarła tyle razy,
    ile jest ludzi na świecie,
    żeby oni nie musieli już umierać,
    nawet Niemcy.

    I żeby ludzie wcale nie wiedzieli,
    że ja umarłam za nich,
    żeby nie było im smutno.

    /19-07-22

    How Science Can Determine Human Values Sam Harris
     …  maximizes the welfare or flourishing of human beings
     …  terms like…"deontology" increases the amount of boredom in the universe
     …  Argumentum ab boredom
     …  Richard Rorty was fond of arguing that there was “no interesting work” to be done on the notion of “truth”
     …  utilitarianism that strikes so many people as scientific
     …  The total amount of well-being is a function of what happens in all of the human brains in the world, which again can in principle be measured.
     …  I don’t want to criticize anyone for not knowing that utilitarianism has been the dominate moral view in philosophy, law, welfare economics, and public policy making for the last two hundred years,
     …  what is good for people is objective, maybe in the same way that we think of “health” as objective.
     …  Smoking and mountain climbing are bad for my health, but .. what I want. .. my .. preferences are a mess: contradictory, ignorant, and intransitive
     …  utilitarianism is an example of: consequentialism
     …  morally right .. the best consequences
     …  Do the ends always justify the means? .. Of course
     …  any moral theory can be “consequentialized” .. by properly weighting the relevant consequences
     …  if we assume that utilitarianism is true, then science will help us apply it. Maybe. No, probably. But that’s not really the issue – at least for ethics. /19-07-15

    AI auto business
     …  six levels of automobile autonomy:
    Levels 0 equals no autonomy, and Level 1 is bare minimum assistance - adaptive cruise control and lane warning tech. Ultimately, how the car functions and drives are dependent on the driver.
    Level 2 is what we see in most of the modern cars of today - assistance with steering, acceleration, braking or several systems working together. The driver remains in total control.
    The jump to level 3 is enormous. With level 3, a car could operate, driver-free, in a straightforward environment - interstates for example. The driver still needs to take in more complex situations.
    Level 4 is full automation but in a highly controlled environment - think predetermined routes or pre-set speed limits or geofencing to contain the vehicles to a predefined area. Pedals and steering wheels may or may not be present, and only in highly specific instances would a human be called upon to take control.
    Level 5, is the summit of self-driving, and what every sci-fi film of the past five decades has promised drivers: no steering wheels, no pedals, just pure AI. Waymo is making a push to get there first, but mass-produced, fully self-driving vehicles for both commercial and non-commercial use is still at least a decade away.
     …  We overestimated the arrival of autonomous vehicles...its applications will be narrow, what we call geo-fenced, because the problem is so complex. /19-07-15

    childhood .. intelligence
     …  Turing .. the imitation game as a way of trying to figure out whether a system is intelligent or not,
     …  why not rather try to produce one which simulates the child?
     …  systems that are going to learn about the external world, the system that we know of that does that better than anything else is a human child
     …  children .. a separate kind of intelligence
     …  a very long period of immaturity and dependence, and a great deal of parental investment
     …  So, you start out with a system that’s very plastic but not very efficient, and that turns into a system that’s very efficient and not very plastic and flexible.
     …  explore-exploit tradeoffs
     …  childhood as evolution’s way of doing simulated annealing
     …  children is that they’re noisy. They produce a lot of random variability.
     …  psychedelic drugs neurally is that it increases the local connections and breaks the long-distance network connections. It literally induces plasticity and induces more synaptogenesis.
     …  Simulated annealing does a bad job of using local gradient information, which is the basis of back propagation in machine learning.
     …  start out with lots of local connectivity and then as time goes on you get segregation /19-07-14

    Liberté, égalité, laicité /19-07-14

    A complete diagram of an animal's nervous system
     …  C. elegans's brains .. one millimeter long
     …  connectomics
     …  the structure of the nervous system is revealing how animals behave
     …  One thousand cells make up their nervous system with a few hundred neurons.
     …  While the synaptic pathways in the two sexes are substantially similar, a number of the synapses differ in strength, providing a basis for understanding sex-specific behaviors
     …  many of the same molecules as the human nervous system /19-07-13

    Humans and Neanderthals
     …  Apidima
     …  A 210,000-year-old skull is the oldest Homo sapiens fossil found outside Africa.
     …  Neanderthals slowly evolved in Europe, largely isolated from other kinds of hominins. When modern humans expanded out of Africa, their movements into Europe might have been stalled by the presence of the already successful Neanderthals.
     …  Europe as ‘fortress Neanderthal’
     …  Finds like 300,000-year-old bones from Jebel Irhoud in Morocco suggest that our species arose from several diverse populations that lived across Africa.
     …  story of Europe, in which modern humans eventually replaced the long-dominant Neanderthals, is too simple.
     …  while they did intermittently meet and mate, the groups weren’t in constant contact. “I don’t think they coexisted,”
     …  our “ultimate domination.” /19-07-13

    What If Life Did Not Originate on Earth?
     …  The Curiosity rover recently discovered .. relatively large concentrations of methane gas (2e-8)
     …  life on Mars .. ?
     …  the origins of life
     …  viewing life as having started here is a little bit presumptuous. It seems we’re very, very, very special
     …  I find the idea aesthetically appealing that life as we know it is universal across the Milky Way.
     …  once it evolves, it spreads .. Gary Ruvkun /19-07-08

    Octopus Arms Are Capable of Making Decisions Without Input From Their Brains
     …  With the ability to use tools, solve complex puzzles, and even play tricks on humans just for funsies, octopuses are fiercely smart.
     …  cephalopods have evolved differently from pretty much every other type of organism on Earth.
     …  two-thirds of an octopus's neurons are spread throughout its body
     …  process sensory information on the fly, allowing the octopus to react faster
     …  maybe even actually alien
     …  It's an alternative model for intelligence /19-07-07

    conservatism .. not an evolution of conservatism, but a repudiation of it
     …  To be conservative is to prefer the familiar to the unknown, to prefer the tried to the untried, fact to mystery, the actual to the possible, the limited to the unbounded, the near to the distant.
     …  Universities are a right-wing-free zone.
     …  At its best conservatism can be a steadying influence. It is reasonable and wise; it values competence; it is not in a hurry. Those days are over. Today’s right is on fire and it is dangerous. /19-07-05

    Gdzie jest życie wewnętrzne, zastanawiał się pewien student filozofii, skoro świat jest tak szczelnie wypełniony życiem zewnętrznym?
     …  I tam też nie ma spokoju.
     …  Wozy pełne siana .. Tutaj nie ma życia wewnętrznego
     …  zagajniki .. nie widzę wcale pustej przestrzeni
     …  W oknach mrugają ekrany komputerów. To nie tutaj.
     …  tom wierszy .. teraz już na pewno .. Nie .. tylko metafory i porównania
     …  Idę do muzeum .. niektóre z nich podobają mi się bardzo, lecz nie znajduję ..
     …  Ale i we mnie .. przeważają echa i refleksy .. wypełniony twarzami i głosami innych ludzi. Czyżby życie wewnętrzne nie istniało wcale?
    Adam Zagajewski/W cudzym pięknie str. 136/19-07-02

    Controlled Hallucination
     …  Perception itself is a kind of controlled hallucination .. acts as feedback on your expectations. It allows you to often correct them and to refine them.
     …  it provides a way of moving towards a third generation of artificial intelligence.
     …  a quantifiable grip on how neural processing weaves together with bodily processing weaves together with actions out there in the world.
     …  The nature of intelligence looks very different when we think of it as a rolling process that is embedded in bodies or embedded in worlds.
     …  hollow mask illusion .. We human beings have very strong expectations about faces.
     …  The Bayesian brain
     …  to have the right model of the world and the other is to change how the world is to fit the model that you have.
     …  The wiring diagram for motor cortex and the wiring diagram for sensory cortex look surprisingly similar
     …  constructive computational story. This is where human experience lives .. where this leaves the notion of veridical perception.
     …  You experience a structured world because you expect a structured world
     …  correct them and to refine them. But the heavy lifting seems to be being done by the expectations.
     …  hallucination is a kind of uncontrolled perception
     …  illusionist view. A large part of this debate over consciousness is misguided because there's nothing there. There's a multidimensional matrix of real things, and among those real things, there's a tendency to think there's another thing and that other thing isn't real. That's one way of thinking about it.
     …  The thing that I don't think is real is qualia.
     …  Dave Chalmers has lately called the meta hard puzzle or the meta hard question.
     …  why we think that the conscious mind might be something very distinct from the rest of the physical order
     …  you're the sort of robot that might invent a hard problem, and might begin to think that there's more than a grain of truth in dualism.
     …  Dan Dennett's take on consciousness is a perfect fit with a predictive processing take on consciousness.
     …  predicting our own embodied responses to things might lead us down the track of thinking that qualia are fundamental special goings on inside us. I might predict some of my own ooing and awing responses to the cute baby, and when I find myself in the presence of the cute baby, I make those responses and I think that cuteness is a real genuine property of some things in the world.
     …  we're fooled by our own Bayesianism here
     …  But you don't need the weird intervening qualia; you just have responses that come about in certain circumstances. There's a rather natural fit between Dan's approach and these approaches, and they're both a kind of illusionism where we're both saying whatever consciousness really is, it can't be what Dave Chalmers thinks it is. /19-07-01

    automation of jobs
     …  susceptibility to computerisation
     …  doom-mongers .. technological joblessness just around the corner .. middle-class jobs will vanish .. a wealthy plutocracy could “shut itself away in gated communities or in elite cities .. The unemployed masses will subsist on a universal basic income.
     …  the past new technology has always ended up creating more jobs than it destroyed
     …  even though it eventually increases the overall size of the economic pie, automation is also likely to boost inequality in the short run
     …  reforming education systems to boost early-childhood education /19-06-28

    We will develop new worlds
     …  David Chalmers has established himself as a leading thinker on consciousness
     …  Artificial general intelligence, A.G.I., is a system capable, like us humans, of performing open-ended tasks independent of specific problems or contexts — conversation, common-sense reasoning, experiential learning and so on.
     …  Deep learning is great for things we do perceptually as human beings — image recognition, speech recognition and so on. But when it comes to anything requiring autonomy, reasoning, decisions, creativity and so on, A.I. is only good in limited domains.
     …  40-to-100-year time frame
     …  “I know objectively that I’m just a collection of silicon circuits, but from the inside I feel like so much more.”
     …  Immanuel Kant thought that morality is part of rationality. There’s the thought that a superintelligent A.I. will turn into a super-moral one, that it will turn into a sort of Kantian being that will only take on goals it can universalize for everyone. That’s a very speculative view of how A.I. will be. /19-06-26

    How Life Began on Earth?
     …  Jack Szostak (pronounced SHAH-stak)
     …  On a young, rocky planet, how might chemicals have come together in just the right way to form the very first cells? How did those primitive cells start behaving like life: growing, dividing, and passing on advantageous traits to the next generation?
     …  reconstruct in the lab the long pathway that led from chemicals in space, to Earth’s formation, to pre-life chemistry
     …  how it would grow and divide and start to replicate, and eventually evolve
     …  We may not know what actually happened, but maybe we can work out different possible paths
     …  Known as “directed evolution,” this process involved introducing mutations into the RNA
     …  how evolution got started all by itself on the early Earth
     …  three big fundamental scientific questions .. the origin of life, the origin of the universe, and the origin of the mind or consciousness
     …  earliest cells developed on land in ponds or pools, possibly in volcanically active regions. Ultraviolet light and lightning strikes
     …  volcanic activity could create hot and cold temperature fluctuations helpful for certain chemical reactions
     …  life might have started outside cells, with free-floating molecules encountering each other
     …  genetically encoded proteins are far too complex to have formed spontaneously on early Earth
     …  Maybe life didn’t start with RNA. Maybe there’s something simpler, easier to make, easier to replicate.
     …  “metabolism-first” hypothesis
     …  Szostak’s lab now focuses almost entirely on how primordial RNA might have copied itself.
     …  Our current model is that you start out with something that’s messy and has a lot of different variations in it, and over cycles of replication, you end up with something that’s closer to modern homogeneous RNA.
     …  I do hope to be able to build an evolving cellular system /19-06-26

    Manuela Gretkowska: PLUS MINUS WOLNOŚĆ
     …  Śmieszy mnie bicie się polskiej inteligencji w pierś: nasza wina, tyle lat nie edukowaliśmy narodu, nie pochylaliśmy się nad maluczkimi. Gnojami, które zabierają nam wolność. Popatrzcie na nich w sejmie, na ich posłów
     …  Kiedy w Niemczech drugą siłą polityczną stają się Zieloni, u nas największym problemem jest czy starcy w sutannach poprą starca w paranoi. Młodzież, wszędzie indziej w ekologicznej awangardzie, u nas głosuje tylko w 25% i do tego większość na konserwatywnych idiotów.
     …  Ulubiona pieśń kościelna: „Dzięki nam uzyskaliście wolność”. A przez kogo straciliśmy ją na 200 lat? Co zrobiliście, żeby uratować wtedy Rzeczpospolitą, zamiast rozmiękczać ją w infantylnej Sarmacji? Wszystko, byle nie dopuścić do protestanckiej dyscypliny myślowej i moralnej. /19-06-25

    Smok został pokonany pewnej nocy, przez dziecko albo przez dziewicę, nie wiemy tego na pewno, w każdym razie zdechł.
    Adam Zagajewski, Solidarność i samotność str. 62 /19-06-24

    Emotion AI
     …  artificial intelligence learns to interpret and respond to human emotion
     …  measures, understands, simulates, and reacts to human emotions
     …  affective computing, or artificial emotional intelligence
     …  The paradigm is not human versus machine — it's really machine augmenting human.
     …  Machines are very good at analyzing large amounts of data
     …  listen to voice inflections and start to recognize when those inflections correlate with stress or anger
     …  micro-expressions on humans’ faces that might happen even too fast for a person to recognize
     …  the technology uses the person’s phone or laptop camera to capture their reactions while watching a particular advertisement
     …  helps call center agents identify the moods of customers
     …  Mental health
     …  recognizing emotions in an African American face sometimes can be difficult for a machine that’s trained on Caucasian faces, /19-06-21

    changing nature of war
     …  surveillance and other stealthy warcraft is given higher priority.
     …  But now America faces rivals, such as China, that match it technologically. For software, the Pentagon has urged Silicon Valley and other tech firms to overcome their ethical quandaries and help shield American forces from cyber-attacks, or develop machine learning to support them on the battlefield.
     …  hypersonic missiles, which combine velocity—travelling at five times the speed of sound—with pinpoint accuracy.
     …  It is better to fight the next war than the last one. /19-06-14

    Radiocarbon dating can be done on microgram quantities
     …  the materials the artist used
     …  samples of a sufficient size
     …  Laura Hendriks of eth Zurich
     …  millionths of a gram
     …  a sample of paint weighing no more than 200 micrograms
     …  maybe not if their owners are unwilling to contemplate bad news /19-06-10

    Cosmology, Sean Carroll
    1. The Big Bang model is simply the idea that our universe expanded and cooled from a hot, dense, earlier state. We have overwhelming evidence that it is true.
    2. The Big Bang event is not a point in space, but a moment in time: a singularity of infinite density and curvature. It is completely hypothetical, and probably not even strictly true. (It’s a classical prediction, ignoring quantum mechanics.)
    3. People sometimes also use “the Big Bang” as shorthand for “the hot, dense state approximately 14 billion years ago.” I do that all the time. That’s fine, as long as it’s clear what you’re referring to.
    4. The Big Bang might have been the beginning of the universe. Or it might not have been; there could have been space and time before the Big Bang. We don’t really know.
    5. Even if the BB was the beginning, the universe didn’t “pop into existence.” You can’t “pop” before time itself exists. It’s better to simply say “the Big Bang was the first moment of time.” (If it was, which we don’t know for sure.)
    6. The Borde-Guth-Vilenkin theorem says that, under some assumptions, spacetime had a singularity in the past. But it only refers to classical spacetime, so says nothing definitive about the real world.
    7. The universe did not come into existence “because the quantum vacuum is unstable.” It’s not clear that this particular “Why?” question has any answer, but that’s not it.
    8. If the universe did have an earliest moment, it doesn’t violate conservation of energy. When you take gravity into account, the total energy of any closed universe is exactly zero.
    9. The energy of non-gravitational “stuff” (particles, fields, etc.) is not conserved as the universe expands. You can try to balance the books by including gravity, but it’s not straightforward.
    10. The universe isn’t expanding “into” anything, as far as we know. General relativity describes the intrinsic geometry of spacetime, which can get bigger without anything outside.
    11. Inflation, the idea that the universe underwent super-accelerated expansion at early times, may or may not be correct; we don’t know. I’d give it a 50% chance, lower than many cosmologists but higher than some.
    12. The early universe had a low entropy. It looks like a thermal gas, but that’s only high-entropy if we ignore gravity. A truly high-entropy Big Bang would have been extremely lumpy, not smooth.
    13. Dark matter exists. Anisotropies in the cosmic microwave background establish beyond reasonable doubt the existence of a gravitational pull in a direction other than where ordinary matter is located.
    14. We haven’t directly detected dark matter yet, but most of our efforts have been focused on Weakly Interacting Massive Particles. There are many other candidates we don’t yet have the technology to look for. Patience.
    15. Dark energy may not exist; it’s conceivable that the acceleration of the universe is caused by modified gravity instead. But the dark-energy idea is simpler and a more natural fit to the data.
    16. Dark energy is not a new force; it’s a new substance. The force causing the universe to accelerate is gravity.
    17. We have a perfectly good, and likely correct, idea of what dark energy might be: vacuum energy, a.k.a. the cosmological constant. An energy inherent in space itself. But we’re not sure.
    17. We don’t know why the vacuum energy is much smaller than naive estimates would predict. That’s a real puzzle.
    19. Neither dark matter nor dark energy are anything like the nineteenth-century idea of the aether. /19-06-06

    Objective Morality?
     …  Morality is a form of social technology – it is context specific and can go out-of-date
     …  the history of Christianity also features people like John Calvin, who not only banned representations of God, but, like the Taliban, forbade dancing
     …  Extreme disagreements over what people consider morally permissible exist
     …  we seem to be wired to have the capacity for morality, while allowing for variability
     …  a more subtle and nuanced way to understand moral differences?
     …  Metaethics
     …  whether moral statements are even capable of being true or false.
     …  the study of morality from the point of view of game theory.
     …  Morality can be conceived of as a social technology that provides guidance on how people should behave when facing interdependent decision problems.
     …  to the greatest extent possible, given the existence of other people.
     …  Good Samaritan .. indirect reciprocity
     …  Morality, like other forms of technology, can result in competing, incompatible standards, each of which attempt to solve the same underlying social problems.
     …  antonym of objective is not relative, but subjective.
     …  universal human rights, international law, the importance of human dignity, individual autonomy, privacy, and freedom of speech, as well as tolerance and respect for others.
     …  equal treatment of men and women, and greater understanding and appreciation of the variation in sexual orientation. We have eliminated capital punishment, and no longer believe it acceptable to punish children by beating them. Yet these and many other gains are fragile. /19-06-06

    Królem Ugandy był wtedy gej i pedofil ... męczennicy z Ugandy /Polskie Radio 2, Słowo na dzień, 6:55, 19-06-03

    humans know more truths than any species on earth. Yet we also believe the most falsehoods.
     …  power means having the ability to manipulate objective realities: to hunt animals, to construct bridges,
     …  power also means having the ability to manipulate human beliefs,
     …  Earth was conquered by Homo sapiens .. because we are the only mammals that can cooperate in very large numbers.
     …  believing common stories. But these stories need not be true.
     …  completely fictional stories about God, about race or about economics.
     …  Rabbits don’t know that E=mc2 .. No rabbit would have been willing to crash an airplane into the World Trade Center in the hope of being rewarded with 72 virgin rabbits in the afterlife.
     …  whereas the truth is universal, fictions tend to be local.
     …  we want to distinguish our tribe from foreigners
     …  handicap principle, which says that reliable signals must be costly to the signaler. .. male peacocks signal their fitness to female
     …  If you believe your leader only when he or she tells the truth, what does that prove? In contrast, if you believe your leader even when he or she builds castles in the air, that’s loyalty!
     …  the truth is often painful and disturbing.
     …  presidential candidate who tells the American public the truth, the whole truth and nothing but the truth about American history has a 100 percent guarantee of losing the elections.
     …  Some might argue that the long-term costs of believing fictional stories outweigh any short-term advantages in social cohesion.
     …  they believe nonsense in some fields, while being eminently rational in others. /19-05-27

    Fusion power is attracting private-sector
     …  the old joke that commercial fusion power is 30 years away—and always will be.
     …  “They’re all based on good physics. They’re all good people that are doing these programmes.” And the prize is enormous. If even one of the fusion startups succeeds, the world’s electricity supply will be guaranteed—and carbon free—for ever. /19-05-27

    Empathy in Our Selfish World
     …  Empathy evolved as one of humans’ vital survival skills. Over millennia, we changed to make connecting easier. Our testosterone levels dropped, our faces softened, and we became less aggressive. We developed larger eye whites than other primates, so we could easily track one another’s gaze, and intricate facial muscles that allowed us to better express emotion.
     …  we developed vast empathic abilities
     …  we were magnificent—unbeatable super-organisms who hunted woolly mammoths, built suspension bridges, and took over the planet.
     …  In 2007, humanity crossed a remarkable line: For the first time, more people lived in cities than outside of them. By 2050, two-thirds of our species will be urban. Yet we are increasingly isolated.
     …  More than half of Paris’s and Stockholm’s residents live alone, and in parts of Manhattan and Los Angeles that number is north of 90 percent.
     …  For the past four decades, psychologists have measured empathy. The news is not good.
     …  Homeless individuals present one of empathy’s most difficult tests.
     …  VR as “the ultimate empathy machine.”
     …  technology can make it harder for us to see one another. But used differently, it can do just the opposite. /19-05-26

    /The New Yorker/19-05-25

    Venice Time Machine /19-05-21

    Scientists have created the world’s first living organism that has a fully synthetic and radically altered DNA code.
     …  read and redesigned the DNA of the bacterium Escherichia coli (E coli)
     …  removing some of its superfluous codons
     …  The redesigned genetic code was then chemically synthesised and, piece by piece, added to E coli where it replaced the organism’s natural genome.
     …  it’s surprising it grows at all after so many changes /19-05-20

    There’s a 49 Percent Chance the World As We Know It Will End by 2050
     …  Jared Diamond’s new book, Upheaval
     …  to accept responsibility
     …  We can buy different sorts of cars. We can do less driving. We can vote for public transport.
     …  climate .. resources
     …  We have to avoid a nuclear holocaust.
     …  balancing individual interests with community interests /19-05-20

    Art of the Mathematical Conjecture
     …  the Riemann hypothesis — often considered the greatest of great conjectures
     …  the first 10 trillion cases of the Riemann hypothesis have been checked numerically
     …  absolute certainty and want to know why the conjecture is true.
     …  Euler’s conjecture .. a fourth power can never be written as a sum of three other fourth powers
        20,615,6734 = 2,682,4404 + 15,365,6394 + 18,796,7604
     …  The shortest statements can require the longest proofs
     …  There is no such thing as a 99 percent proof.
     …  For two millennia, people tried to prove that Euclid’s fifth postulate
     …  Kurt Gödel .. the greatest logical achievement /19-05-20

    There Is Free Will You make choices even if your atoms don’t.
     …  Sam Harris has dueled philosopher and free-will defender Daniel Dennett for years
     …  Christian List .. Why Free Will Is Real .. tries to bridge the gap
     …  Sean Carroll and philosopher Jenann Ismael, who dissolve the old dichotomies on free will and think that a nuanced reading of physics poses no contradiction for it.
     …  fundamental physics and neurobiology are only part of the story of human behavior.
     …  You may be a big bunch of atoms governed by the mechanical laws, but you are not just any bunch of atoms. You are an intricately structured bunch of atoms, and your behavior depends not just on the laws that govern the individual atoms but on the way those atoms are assembled.
     …  Skeptics miss this point, List argues, because they rely on loose intuitions about causation.
     …  Causation is a higher-level concept.
     …  A free-will skeptic argues, first, that free will requires one or more properties: intentional, goal-directed agency; alternative possibilities—that it must be possible for me to do otherwise; or causal control over our actions. Then the skeptic claims that those properties are not to be found among the fundamental physical features of our world. Different skeptics focus on different properties.
     …  Patricia and Paul Churchland say we should understand human behavior not so much at the cognitive, psychological level where we invoke explicit mental states, goals, intentions, and purposes, but rather at a lower level of description, as the product of biophysical processes in the brain.
     …  Human beings have a strong tendency to ascribe intentions to all sorts of phenomena, like the weather,
     …  Benjamin Libet found that the conscious decision to press a button is not the beginning of the causal sequence that initiates the process,
     …  free will requires intentional agency
     …  the standard arguments against free will lies in a failure to distinguish between different levels of description.
     …  The neuroscientific skeptic is absolutely right that, at the fundamental physical level, there is no such thing as intentional goal-directed agency. The mistake is to claim that there is no such thing at all.
     …  Intentional agency is an emergent higher-level property, but it is no less real for that.
     …  the best way to make sense of those patterns and regularities is by assigning intentional agency to the people involved.
     …  Wait, I’m not sure I want indeterminism at the human level. I want my decisions to flow out of my deliberations, not to be the product of chance.
     …  This is subtle. There are different forms of indeterminism. In statistical physics, indeterminism is associated with randomness. But in the social sciences, we use a different kind of indeterminism based on option availability.
     …  In the sciences, we test for causation by looking for systematic correlations
     …  There is no conceptual reason why sophisticated AI systems could not qualify as bearers of free will. /19-05-18

    falsificationism
     …  Karl Popper .. what distinguishes science from non-science is falsifiability
     …  Popper’s philosophy of science is a product of his view on the problem of induction
     …  while you can’t prove that a theory is true, you can at least show that it’s false
     …  most philosophers of science think falsificationism, despite its appeal, is actually mistaken
     …  a theory is never falsifiable simpliciter, but only relative to a set of background assumptions
     …  Kuhn was basically right about the sociology of theory change, but ...
     …  as when creationists posit that God planted fossils that seem very ancient to test our faith
     …  the search for such a criterion of demarcation between science and non-science, whether in terms of falsifiability or not, is probably hopeless. If you want to argue that something is pseudoscience, there is no shortcut that will save you the pain of having to engage with it and grapple with the arguments of its proponents. /19-05-17

    disorder
     …  Planets, stars, life, even the direction of time all depend on disorder. And we human beings as well.
     …  randomness, novelty, spontaneity, free will and unpredictability.
     …  order .. systems, law, reason, rationality, pattern, predictability.
     …  like twilight and dawn, they have much in common.
     …  Ernst Gombrich believed that, although human beings have a deep psychological attraction to order, perfect order in art is uninteresting.
     …  delight lies somewhere between boredom and confusion.’ Too much order, we lose interest. Too much disorder, and there’s nothing to be interested in.
     …  the symmetry of a snowflake .. the amorphous shape of a high-riding cloud
     …  Clausius coined the term entropy
     …  Disorder is also the answer to the profound question: why is there something rather than nothing?
     …  If there were an equal number of particles and their antiparticles
     …  there is a slight asymmetry in how they interact
     …  well-known example of disorder in biology is the shuffling of genes
     …  From an evolutionary point of view, order implies predictability, patterns, repeatability – all of which allow us to make good predictions.
     …  More unexpected, perhaps, is how attentiveness to surprise, chance and novelty can also confer an advantage.
     …  departing from our familiar routines
     …  DRD4-7R .. ‘the wanderlust gene’. It occurs in about 20 per cent of the population, /19-05-16

    quantum mechanics prevent even a single particle from reversing its own course through time
     …  the atoms of a scrambled egg can’t be unscrambled back inside a pristine shell. Now it seems that, under general conditions, even a single particle probably can’t go backward without help and careful tinkering.
     …  On paper, the basic laws of physics are reversible
     …  the arrow of time takes its direction not only from big numbers.
     …  Schrödinger equation .. is equally valid running forward or backward. But getting a wave function to go in reverse is no small trick.
     …  Because of the uncertainty principle, the quantum ball will never return back to the point of the origin
     …  whether the irreversibility of time is a fundamental law of nature or whether, on the contrary, it might be circumvented.
     …  The time-reversal experiment was a four-step process. First the qubits ..
     …  Now everybody can make qubits younger /19-05-13

    I Watched an Entire Flat Earth Convention
     …  Speakers recently flew in from around (or perhaps, across?) the earth for a three-day event held in Birmingham
     …  flat earthers do seem to place a lot of emphasis and priority on scientific methods and, in particular, on observable facts.
     …  try to "look for multiple, verifiable evidence"
     …  "always do your own research and accept you might be wrong"
     …  flat earthers seem to trust and support scientific methods, what they don't trust is scientists
     …  what their resurgence and public conventions tell us about science and knowledge in the 21st century.
     …  Flat earthers and populism
     …  Science is increasingly facing problems with its ability to communicate ideas publicly
     …  the success of this UK event – and the large conventions planned in Canada and America this year – it seems the flat earth is going to be around for a while yet. /19-05-13

    Amazon Echo, Google Home, Apple HomePod .. are spreading rapidly
     …  working on ways to extend smart speakers’ sensory ranges.
     …  vision as well as hearing.
     …  lidar
     …  gestures
     …  employs it to recognise utensils and ingredients laid out on a preparation surface and to check everything needed is available to cook a particular dish.
     …  recognises the owner’s smartphone and connects it automatically,
     …  Knocki, an accelerometer which can be fixed to a surface to detect the vibrations made by someone knocking on that surface. .. making the appropriate pre-arranged number of knocks.
     …  Audio Analytic .. sound-recognition technology /19-05-13

    5G Terrifying Potential
     …  especially susceptible to cyberattacks and surveillance.
     …  hundred times faster
     …  everything from toasters to dog collars to dialysis pumps to running shoes will be connected
     …  fourth industrial revolution
     …  5G will make anonymity a historical artifact.
     …  facial-recognition technology
     …  what that world would look like. /19-04-29

    The Ontological and Theological Dimensions of Art in the Eastern Christian Tradition
     …  the synergy of God and man.
     …  the source of the icon is not some creative work of a master who is trying to paint/write a religious-themed picture, but God Himself, who contains perfect models of all creatures, and who, more im- portantly, manifests Himself as the Second Person of the Holy Trinity, who shares His essence/nature and actions with the other Persons.
     …  nor is it about “being appealing”, but as an objective expression of Beauty in itself.
     … /Teresa Obolevitch/19-04-29

    Make Physics Real Again
     …  those properties don’t even exist until they’re observed
     …  Richard Feynman .. “nobody understands quantum mechanics”
     …  Copenhagen interpretation .. "Shut up and calculate!"
     …  quantum mechanics is the theory that any new idea in fundamental physics must accommodate.
     …  Quantum mechanics is in essence a tool to predict the outcomes of measurements. .. logical positivism of the Vienna Circle
     …  scientific realist: The aim of science is to understand a world that exists independently of our observation; thus, quantum mechanics, despite its impressive success, could not be the whole story.
     …  “the measurement problem”
     …  Schrödinger’s cat .. In fact, Schrödinger offered it as a reductio ad absurdum of the Copenhagen interpretation.
     …  Einstein found nonlocality more problematic than the probabilistic nature of quantum mechanics.
     …  EPR .. hidden variables .. Bell
     …  the wisest course at present is accepting a pluralism of interpretations
     …  Quantum physics is at least approximately correct.... We just don’t know what that means yet. /19-04-26

    Secular Humanism is Not a Religion
     …  Even environmentalism has been described as a religion.
     …  literal transubstantiation of wine and wafers, which the Vatican has immunized against disproof by deeming the process undetectable by empirical means.
     …  the absence of evidence is indeed evidence for absence if the evidence should have been there. .. Loch Ness Monster doesn’t exist.
     …  the diversity of morality among secular humanists is far wider than that of followers of a given religion
     …  abortion is murder .. comes from the claim that fetuses, like adults, have souls
     …  that homosexuality is immoral comes from scripture.
     …  whatever God says is good is good.
     …  Stephen Jay Gould’s unconvincing attempt to harmonize science and religion in his 1999 book Rocks of Ages. There Gould proposed his NOMA (Nonoverlapping Magisteria)
     …  atheists are not automatically amoral. /19-04-26

    artificial superintelligences
     …  Dennett thinks we should protect ourselves by doing all we can to keep powerful AIs operating at the level of suggestion-making tools, while Chalmers is impressed by the market forces that will probably push us into devolving more and more responsibility to these opaque and alien minds.
     …  “epistemic” actions that both test and improve their model of that world.
     …  Active Inference machines.
     …  epistemic agendas and have an Umwelt of their own. These are the only kind of AIs that may, I believe, end up being conscious of themselves and their worlds—at least in any way remotely recognizable as such to us humans.
     …  real explorations within the vast space of possible minds. /19-04-25

    David Attenborough, BBC, Climate Change
    /19-04-23

    Peterson-Žižek
     …  Happiness: Capitalism vs Marxism
     …  The great surprise of this debate turned out to be how much in common the old-school Marxist and the Canadian identity politics refusenik had.
     …  They needed enemies, needed combat, because .. they had so little to offer.
     …  Žižek .. “We will probably slide towards apocalypse”
     …  They are both self-described “radical pessimists”
     …  They do not have an answer to the real problems that face us: the environment and the rise of China as a successful capitalist state without democracy.
     …  They returned to their natural subject: who is the enemy? /19-04-23

    Consciousness Come in Degrees?
     …  depends on what you think consciousness is
     …  Every living thing responds selectively to its immediate environment. Rocks don’t. One-celled organisms do. Viruses are a borderline case.
     …  When we say perceive, we’re thinking of sense organs, inputs and information-processing, however rudimentary.
     …  vague and admit many borderline cases
     …  Perception itself certainly admits degrees.
     …  Could a robot be a conscious being .. I don’t see why not. .. a robot can amass information through its sensors and build a representation of the external world.
     …  ‘conscious memory’ or a ‘conscious decision’—we mean not only being in a mental state but being aware of that very mental state from the inside.
     …  we are directly aware of.
     …  Awareness of your own mental states is often called “state” consciousness. Creatures that have state consciousness have the ability to represent their own mental states. It’s an empirical question which organisms do have that capacity. Human beings obviously have it. There is some evidence that gorillas do.
     …  the idea that animals ‘process’ pain but do not ‘feel’ it: ‘Rats and chickens systematically choose and self-administer painkillers when and only when they are distressed.
     …  pain itself and not awareness of it is what matters morally.
     …  self-medicating behaviour was just a direct response to the pain itself
     …  Chiropterological (bat) ethology and neuroscience may detail the bat’s sensory system down to the last molecule and bit of information processed, but neither science nor anything else could tell us humans what it’s like for the bat to experience its sonar sensation.
     …  Phenomenal consciousness is ‘intrinsically perspectival’
     …  the metaphysics of mind
     …  Daniel Dennett and others argue that if we really do know every detail of both the bat’s sonar sense and the human psychobiology and chemistry, we could work out what it’s like for the bat
     …  ‘What it’s like’ pervades the universe, and panpsychism is true. Ha-haa!
     …  how physical matter produces consciousness
     …  In Stephen Hawking’s words, ‘it is consciousness that breathes fire into the equations.’
     …  So, does consciousness come in degrees? Perceptual and state consciousnesses do. But phenomenal consciousness is different, and a whole different beast. /19-04-19

    central-bank independence
    The world has grown used to low and stable inflation under the stewardship of technocrats. But President Donald Trump is laying siege to the Federal Reserve, Brexiteers are rubbishing the Bank of England and the Turkish president has been in a tug-of-war with his central bank. In India a pliant insider has cut rates ahead of an election. And the European Central Bank is poised to become part of a wider political struggle over who runs Europe’s institutions. As an economic slowdown looms, there is a need for a debate on central banks’ objectives and tools.
    The Economist/19-04-12

    Image of a Black Hole
     …  M87, about 53 million lightyears
     …  historic image shows a ring of light emitted by gas falling into the black hole.
     …  The Event Horizon Telescope (EHT) .. eight different telescopes across the world .. very-long-baseline interferometry
     …  wavelength of 1.3 mm
     …  Almost all galaxies have black holes at their centres. .. Our Milky Way galaxy has a fairly small black hole about 4 million times as massive as our Sun. .. M87 is a veritable monster, weighing 6,500-million-times as much as our Sun. Its event horizon, its outermost boundary across which nothing can escape, is about 20,000 million km wide – bigger than the entire Solar System.
     …  Why did the EHT not image the black hole in our own galaxy? .. 26,000 light years .. its brightness varies much more rapidly, it is harder to process the data /19-04-12

    Mark Zuckerberg
     …  “At our scale,” he wrote, “we’ll always make mistakes.”
     …  the only significant reckoning for the tech industry has come from the European Union
     …  we get up to speed quite quickly, because these are fast moving technologies, fast moving markets, and if we want our democracies to set the direction, instead of businesses doing so, it’s a matter of urgency.
     …  Facebook even deployed an app that looked for rivals that it could either buy or kill. /19-04-11

    Homo luzonensis .. 50,000 years ago
     …  Philippine
     …  You get different evolutionary pathways on islands
     …  efforts to extract DNA from H. luzonensis have failed so far
     …  complicate simple scenarios of human evolution /19-04-11

    Redesigning life
     …  synthetic biology
     …  For the past four billion years or so the only way for life on Earth to produce a gene was by copying a gene it already had. No longer. Genes can now be written from scratch and edited repeatedly, like text in a word processor. The ability to engineer living things which this provides represents a fundamental change in the way humans interact with the planet’s life, potentially greater in impact than the dawn of agriculture or the exploitation of fossil fuels.
    The Economist/19-04-05

    Why are we impatient? It’s a heritage from our evolution
     …  The link between time and emotion is a complex one
     …  Social Acceleration: A New Theory of Modernity .. speed of human movement from pre-modern times to now has increased by a factor of 100
     …  impatience culture—fast-food
     …  small rewards now over larger ones later
     …  we are getting to be a more and more impulsive society
     …  there an absolute mechanism for measuring time in the brain
     …  brain judges time by counting the number of signals it is getting from the body. So if the signals come faster,
     …  meditation and mindfulness
     …  Could I really fix this maladapted mechanism so easily? /19-04-05

    history of life on Earth
     …  sixty-­six million years ago
     …  The asteroid struck a shallow sea where the Yucatán peninsula is today.
     …  Some of the ejecta escaped Earth’s gravitational pull and went into irregular orbits around the sun.
     …  Mars was eventually strewn with the debris
     …  About seventy-five per cent of all species went extinct. More than 99.9999 per cent of all living organisms on Earth died
     …  the planet was perhaps entirely free of ice.
     …  “three-­metre problem.” .. almost no dinosaur remains have been found in the layers three metres, below the KT boundary,
     …  Hell Creek .. DePalma
     …  the whole KT event preserved in these sediments
     …  we see direct victims.
     …  In the next epoch, mammals underwent an explosion of adaptive radiation /19-04-04

    spalenia książek
    Komunikat Biblioteki Narodowej w sprawie publicznego spalenia książek
    Data publikacji: 2/4/2019
    Dokonując aktów publicznych należy rozważyć ich konsekwencje i przewidzieć możliwe reakcje. Publiczne spalenie książek w Polsce budzi wyjątkowe skojarzenia. Odsłania historyczne konteksty, zwłaszcza tu – w kraju dotkniętym w sposób wyjątkowo okrutny barbarzyństwem totalitaryzmów, które z palenia książek uczyniły symbol zniszczenia, w kraju, w którym w czasie drugiej wojny światowej zniszczono 70% zasobów bibliotek, którego Biblioteka Narodowa jako symbol niepodległości została świadomie podpalona przez niemieckich okupantów i w rezultacie niemal całkowicie unicestwiona – właśnie tu palenie książek, bez względu na pobudki i intencje, musi zostać uznane za nieodpowiednie i wzbudzić słuszny sprzeciw. To niebezpieczna forma działalności duszpasterskiej. Jak słusznie pisał św. Tomasz z Akwinu: „Nie można usprawiedliwić złego działania podjętego w dobrej intencji”. Cnota roztropności kształtuje zdolność do rozeznawania dobra i wyboru właściwych środków do jego czynienia. Aby się świadomie kierować cnotą roztropności, należy korzystać z nabytego doświadczenia, również wcześniejszych pokoleń. Konieczna jest formacja zdrowego sądu i zdolność przewidywania, oparta nie tylko na wiedzy, ale i na wyobraźni, co pozwala uniknąć ostrej krytyki i publicznego zgorszenia.
    /19-04-03

    Brexit has already irreparably damaged research
     …  Utter chaos. Disaster. A national act of self-harm. All these terms have been used by leading scientists to describe the state of the United Kingdom’s plans to leave the European Union. Scientists are rarely so sharp tongued.
     …  Nature /19-04-02

    ethicists .. are no more ethical than the rest of us
     …  The one exception was vegetarianism: Ethicists were both more likely to say that it was immoral to eat meat, and more likely to be vegetarians themselves.
     …  few ethicists seem to have considered their own behavior. /19-04-02

    statistical significance
     …  we should never conclude there is ‘no difference’ or ‘no association’ just because a P value is larger than a threshold such as 0.05
     …  the entire concept of statistical significance to be abandoned.
     …  We are not calling for a ban on P values. Nor are we saying they cannot be used as a decision criterion in certain specialized applications (such as determining whether a manufacturing process meets some quality-control standard).
     …  stop to the use of P values in the conventional, dichotomous way
     …  When P values are reported, they will be given with sensible precision (for example, P?=?0.021 or P?=?0.13) — without adornments such as stars or letters to denote statistical significance and not as binary inequalities (P? ?0.05).
     …  Nature /19-03-28

    evolution of consciousness to when fish first climbed on to land, and could suddenly see much farther, which in turn made it advantageous to plan further in advance. /19-03-28

    Nationalism The Biology of Us and Them
     …  His first mistake was looking for food alone
     …  bigger mistake was wandering too far up the valley into a dangerous wooded area. This was where he risked running into the Others
     …  and the Others took over the whole valley.
     …  they are chimpanzees in a national park in Uganda
     …  humans, who share more than 98 percent of their DNA with chimps, also divide the world into “us” and “them”
     …  to change their behavior. (The Swedes spent the seventeenth century rampaging through Europe; today they are, well, the Swedes.)
     …  Our brains distinguish between in-group members and outsiders in a fraction of a second,
     …  automatic and unconscious
     …  oxytocin
     …  Coke or Pepsi
     …  Make America Great Again
     …  myths of victimhood and dreams of revenge. /19-03-28

    Quantum computing for the very curious
     …  Turing’s reasoning: Computing is normally done by writing certain symbols on paper. We may suppose this paper is divided into squares like a child’s arithmetic book. In elementary arithmetic the two-dimensional character of the paper is sometimes used. But such a use is always avoidable, and I think that it will be agreed that the two-dimensional character of paper is no essential of computation. I assume then that the computation is carried out on one-dimensional paper, i.e. on a tape divided into squares.
     …  David Deutsch .. Is there a (single) universal computing device which can efficiently simulate any other physical system?
     …  Quantum computing and quantum mechanics are famously “hard” subjects
     …  the essay incorporates new user interface ideas to help you remember what you read.
     …  developing a new and improved form of reading.
     …  My own conclusion is that today there is no interpretation of quantum mechanics that does not have serious flaws. This view is not universally shared. Indeed, many physicists are satisfied with their own interpretation of quantum mechanics. But different physicists are satisfied with different interpretations. — Steven Weinberg, Nobel Laureate in Physics
     …  is there a single computing device that can efficiently simulate any other physical system? At the moment, the best candidate humanity has for such a computing device is a quantum computer.
     …  The theory of computation has traditionally been studied almost entirely in the abstract, as a topic in pure mathematics. This is to miss the point of it. Computers are physical objects, and computations are physical processes. What computers can or cannot compute is determined by the laws of physics alone, and not by pure mathematics. — David Deutsch
     …  what a quantum computer is .. while the model is simple, it contains remarkable depths, and exploring it could occupy many lifetimes.
     …  humanity doesn’t yet know what the higher-level abstractions are.
     …  classical computers are terrible at simulating quantum systems.
     …  We’ve been living too early in history to understand how incredibly important quantum simulation really is.
     …  Peter Shor’s beautiful quantum factoring algorithm
     …  Perhaps some future class of quantum gravitating computers, more powerful even than quantum computers, will be needed to simulate quantum gravity. /19-03-26

    the current state of global faith
     …  Three-quarters of humanity profess a faith; the figure is projected to reach 80 per cent by 2050
     …  mainstream religion would fade away within a few generations;
     …  whether religion does more harm than good
     …  “Darwin appeared, and, under the guise of a foe, did the work of a friend”, because he held that God had made a world which makes itself.
     …  believers are consciously or unconsciously echoing a concern seen in much ancient philosophy.
     …  why join a community of belief in the first place? Why can’t you be “spiritual” in isolation,
     …  Is it open-handed, outward-looking, conducive to human flourishing in the fullest sense? /19-03-22

    origin of religions
     …  Big people, big gods
     …  What came first: all-seeing gods or large societies?
     …  The god of Abraham sees everything, always.
     …  A “Big God” of this sort—a supernatural “eye in the sky” who cares whether people do right by others—is a feature of most of the world’s top religions.
     …  gods who watch over small societies tend to demand only that people show deference to them. Big Gods come later.
     …  small societies do not need a supernatural policeman. If everyone knows everyone else,
     …  What could be better than an all-seeing eye that enforces co-operation between friends and strangers alike?
     …  which comes first, a Big God that permits a big society, or a big society that requires a Big God?
     …  accumulated data on more than 400 societies that have existed in the past 10,000 years.
     …  Big Gods appeared about 100 years after a society took a leap forward in complexity
     …  today’s religions did not create modernity but, in the past at least, they held it together. /19-03-21

    moratorium on heritable genome editing
     …  changing heritable DNA (in sperm, eggs or embryos) to make genetically modified children.
     …  By ‘global moratorium’, we do not mean a permanent ban.
     …  moratorium does not apply to germline editing for research uses, provided that these studies do not involve the transfer of an embryo to a person’s uterus.
     …  in China, biophysicist He Jiankui reportedly edited embryos to create at least two babies.
     …  there is wide agreement in the scientific community that, for clinical germline editing, the risk of failing to make the desired change or of introducing unintended mutations (off-target effects) is still unacceptably high.
     …  ‘genetic correction’ and ‘genetic enhancement’.
     …  even to confer entirely new biological functions, such as the ability to see infrared light
     …  SLC39A8, for instance, decreases a person’s risk of developing hypertension and Parkinson’s disease, but increases their risk of developing schizophrenia,
     …  Attempting to reshape the species on the basis of our current state of knowledge would be hubris.
     …  Genetic enhancement of any sort would be unjustifiable at this time, given the scientific considerations already mentioned. The issue of genetic correction is more complex.
     …  Unequal access to the technology could increase inequality. Genetic enhancement could even divide humans into subspecies. /19-03-15

    morality-as-cooperation
     …  Seven moral rules found all around the world
     …  What is morality? And to what extent does it vary around the world?
     …  'morality-as-cooperation' .. morality consists of a collection of biological and cultural solutions to the problems of cooperation recurrent in human social life.
     …  The rules:
    help your family
    help your group
    return favors
    be brave
    defer to superiors
    divide resources fairly, and
    respect others' property, were found in a survey of 60 cultures
     …  moral universalists and moral relativists
     …  People everywhere face a similar set of social problems
     …  morality evolved to promote cooperation
     …  there were no counter-examples -- no societies in which any of these behaviors were considered morally bad.
     …  equal frequency across continents
    Source, pdf /19-03-14

    nuclear energy
     …  several nuclear plants in the US closed recently because they can’t compete with cheap shale gas
     …  reactors that have been used for decades—fission, or splitting atoms.
     …  Small modular reactors .. Advanced fission .. Fusion
     …  Fusion .. No earlier than 2035
     …  The first experiments, originally scheduled for 2018, have been pushed back to 2025.
     …  fission simply faces too many barriers to be successful.
     …  many anti-nuclear campaigners don’t distinguish between fission and fusion. /19-03-14

    Rilke, Czwarta elegia
     … 
           Spójrz, umierający
    czyżby nie mieli przeczuwać, jak pełne
    pozoru wszystko, co czynimy  … 

    /19-03-10

    Noam Chomsky
     …  Why Only Us: Language and Evolution
     …  There are no significant analogues or homologues to the human language faculty in other species.
     …  1950s, Noam Chomsky .. began reading .. Konrad Lorenz
     …  1967 .. Biological Foundations of Language
     …  1990s .. Every human language is a finite computational system
     …  The advent of sophisticated machine learning techniques has only served to justify their point of view.
     …  As of 2016, a rough rule of thumb is that a supervised deep learning algorithm will generally achieve acceptable performance with around 5,000 labeled examples per category and will match or exceed human performance when trained with a dataset containing at least 10 million labeled examples. .. Whatever else children may be doing when acquiring their native language, they are not consulting ten million labeled examples.
     …  FOXP2 gene
     …  Language production is a matter of externalization.
     …  genomic work .. The emergence of language occurred earlier than we thought
     …  between 200 kya and 125 kya, the San people in Southern Africa became genomically separated from other human populations.
     …  Birds sing and humans speak; it is irresistibly tempting to see a connection.
     …  SRGAP2C is involved in axon guidance and is found only in Homo sapiens, Neanderthals, and Denisovans.
     …  the antecedents for language were in place 300 million years ago.
     …  humanized mice did, indeed, display increased neocortical size when compared to chimpanzeed mice
     …  The ability to process sequential information is shared across many vertebrate species—perhaps all.
     …  semantic properties of even the simplest words are radically different from anything in animal symbolic systems
     …  we now know that evolution can proceed very rapidly /19-03-08

    A philosopher argues that an AI can’t be an artist
     …  Creativity is, and always will be, a human endeavor.
     …  “superintelligent” successors, which he defines as having “intellect that greatly exceeds the cognitive performance of humans in virtually all domains of interest.”
     …  Schoenberg’s vision involved the spare, clean, efficient minimalism of modernity.
     …  AlphaGo .. The program plays in a style that experts describe as strange and alien. “They’re how I imagine games from far in the future,” Shi Yue, a top Go player, said of AlphaGo’s play. The algorithm seems to be genuinely creative.
     …  deep-learning algorithm is set loose and after some time says, “I’ve found a proof of a fundamentally new theorem, but it’s too complicated for even your best mathematicians to understand.” /19-03-04

    to the moon .. a small metal disk that contains the building blocks of human civilization in 30 million pages of information
     …  civilization backup for future generations
     …  a privately funded Israeli mission
     …  amnesia about our past mistakes
     …  to last at least 6 billion years
     …  a largely symbolic purpose
     …  The Lunar Library reportedly holds a collection of songs, children’s drawings and writings about Israeli culture and history. It also contains the entire English-language version of Wikipedia and a guide to 5,000 languages with 1.5 billion sample translations. /19-03-04

    Artificial intelligence is an existence proof of one of the great ideas in human history: that the abstract realm of knowledge, reason, and purpose does not consist of an élan vital or immaterial soul or miraculous powers of neural tissue. Rather, it can be linked to the physical realm of animals and machines via the concepts of information, computation, and control.
    /Steven Pinker
    In the broadest sense, a person’s quest for understanding is indeed a search problem, in an abstract space of ideas far too large to be searched exhaustively.
    And the ideas that the program does contemplate must be chosen by the program itself, using methods, criteria, and objectives that are also the program’s own.
    /David Deutsch
    /Possible Minds. 25 Ways of Looking at AI ed John Brockman/19-03-03

    religion, even if God’s existence seems unlikely
     …  unsupported by, or even inconsistent with, available evidence.
     …  our modern doxastic conception of religion is largely the result of mistranslation.
     …  religious fictionalism
     …  a meaning-loaded narrative that has been adopted by a particular community to give expression to and foster a form of life defined by its guiding ideals
     …  combine elements of fictionalism with belief in a transcendent reality.
     …  there are fictionalist elements in Christian theology going right back to the Early Church Fathers.
     …  Origen (c.184–253) and Gregory of Nyssa (c.335–395) were proponents of apophatic, or “negative”, theology, according to which the real nature of God is unknowable. Pseudo-Dionysius the Areopagite (late fifth/early sixth centuries) wrote that God is “beyond every assertation” and “beyond every denial”.
     …  The Cloud of Unknowing
     …  we must choose between secular atheism and dogmatic certainty
     …  unable to adopt either .. “spiritual but not religious”
     …  a non-dogmatic approach to spirituality, one that is consistent with uncertain faith, with non-traditional belief and even with outright atheism. /19-02-27

    to exist
     …  Physical theories give us the best available information about what there exists.
     …  Quine .. Hartle-Hawking quantum creation model .. nothingness in physics
     …  the model is unthinkable
     …  If we attempted to construct a physical model from absolute nothing: the zero of existence, no mathematical structure and nothing to interpret, we would not be able to move one step forward. This is why the Leibniz question is so persistent: “Why is there something rather than nothing?”, and his short comment”: “For nothing is simpler and easier than something” (Leibniz, 1908, p. 303). Why then is there something that is neither easy nor simple?
     … /Michael Heller/19-02-26

    Theory of everything
     …  1964 .. Feynman .. the correct laws of physics are expressible in such a tremendous variety of ways
     …  Traditionally, physicists have been reductionists.
     …  the principle of least action also extends to the quantum world.
     …  The existence of this branching, interconnected web of mathematical languages, each with its own associated picture of the world, is what needs to be understood.
     …  Nima Arkani-Hamed .. amplituhedron
     …  It seems inconceivable that this intricate web of perfect mathematical descriptions is random or happenstance. /19-02-20

    oil industry
     …  climate change is becoming hard to ignore. Yet demand for oil is rising and the energy industry is planning multi-trillion-dollar investments to satisfy it. .. ExxonMobil .. It plans to pump 25% more oil and gas in 2025 than in 2017. .. the consequences for the climate could be grave.
    The Economist, Feb 9th 2019/19-02-07

    self-aware machines
     …  Robots have not learned simulate themselves the way humans do.
     …  a major advance in robotics
     …  Initially the robot does not know if it is a spider, a snake, an arm—it has no clue what its shape is. After a brief period of "babbling," and within about a day of intensive computing, their robot creates a self-simulation.
     …  to contemplate and adapt to different situations, handling new tasks as well as detecting and repairing damage in its own body.
     …  Robert Kwiatkowski
     …  Initially, the robot moved randomly and collected approximately one thousand trajectories, each comprising one hundred points. T
     …  then used deep learning
     …  after less than 35 hours of training
     …  self-modeling robot
     …  To test whether the self-model could detect damage to itself .. and the robot was able to detect the change and re-train its self-model.
     …  robotics and AI may offer a fresh window into the age-old puzzle of consciousness.
     …  Philosophers, psychologists, and cognitive scientists have been pondering the nature self-awareness for millennia, but have made relatively little progress
     …  robots now force us to translate these vague notions into concrete algorithms
     …  Self-awareness will lead to more resilient and adaptive systems, but also implies some loss of control
     …  The researchers are now exploring whether robots can model not just their own bodies, but also their own minds, whether robots can think about thinking. /19-02-06

    editing of the genomes of two embryos that are now baby girls
     …  China
     …  Ethics dumping is the carrying out by researchers from one country (usually rich, and with strict regulations) in another (usually less well off, and with laxer laws) of an experiment that would not be permitted at home
     …  “Birth of twins after genome editing for hiv resistance” .. Nature’s editors rejected the paper
     …  crispr-Cas9
     …  In America, in effect, the implantation of genetically modified embryos into a woman’s womb is forbidden.
     …  to graft the head of a patient paralysed from the neck down onto the body of a deceased donor
     …  international register for research involving the genetic modification of human embryos, with registration being a condition for subsequent publication. /19-02-01

    alien life
     …  takes up where Erwin Schrödinger left off
     …  emphasis has shifted from observing and describing to sequencing and calculating.
     …  biology has increasingly become like physics
     …  Paul Davies .. The Demon in the Machine .. information is central not just to doing biology, but to understanding life itself.
     …  If life exists elsewhere in the Universe, Davies wonders, how can we recognize it?
     …  oxygen, carbon dioxide or methane .. the characteristics of the one ecosystem we know, but to accept these as the essence of life seems .. desperately narrow-minded
     …  energy and information are closely related through entropy
     …  living systems can be seen as composed of countless such ‘demons’ (proteins and other cellular machinery) that maintain local order by pumping disorder (often in the form of heat) into their surroundings.
     …  cancer, which he sees less as an example of broken cellular machinery and more as a regression to an earlier evolutionary state, when single-celled organisms responded to adverse conditions by replicating.
     …  a definition of life that depends on its informational characteristics rather than its carbon-based substrate could force a reappraisal of our attitudes towards artificial systems embodied in computers. /19-01-29

    Beauty .. Rethink Evolution
     …  bowerbird bower .. is nothing less than art
     …  This extravagance is also an affront to the rules of natural selection.
     …  species have conspicuous, metabolically costly and physically burdensome sexual ornaments
     …  To reconcile such splendor with a utilitarian view of evolution, biologists have favored the idea that beauty in the animal kingdom is not mere decoration — it’s a code.
     …  indicators of a potential mate’s advantageous qualities
     …  Charles Darwin himself disagreed with this theory.
     …  Darwin .. Animals, he believed, could appreciate beauty for its own sake.
     …  Now .. biologists is reviving Darwin’s neglected brainchild. Beauty, they say, does not have to be a proxy for health or advantageous genes. Sometimes beauty is the glorious but meaningless flowering of arbitrary preference.
     …  And that innate sense of beauty itself can become an engine of evolution, pushing animals toward aesthetic extremes.
     …  aesthetic preference that has nothing to do with survival whatsoever.
     …  how an animal’s eyes and brain shape its perceptions of reality and how its unique way of experiencing the world can, over time, profoundly alter both its physical form and its behavior.
     …  two environments governing the evolution of sentient creatures: an external one, which they inhabit, and an internal one, which they construct. To solve the enigma of beauty, to fully understand evolution, we must uncover the hidden links between those two worlds.
     …  our visual system, for example, may be wired to notice symmetry.
     …  in humans, as in birds, many types of physical beauty and sexual desire have arbitrarily co-evolved without reference to health or fertility.
     …  Beauty is a dialogue between perceiver and perceived.
     …  it is the impulse to recreate water lilies with oil and canvas; it is the need to place roses on a grave. /19-01-13

    Unprovability comes to machine learning
     …  1931 .. Kurt Gödel
     …  continuum hypothesis .. neither proved nor refuted
     …  machine learning .. shares this limitation
     …  probably approximately correct (PAC)
     …  Vapnik–Chervonenkis (VC) dimension, and, in general, results relating learnability to complexity are sometimes referred to as Occam’s-razor theorems
     …  connection between machine learning and data compression .. The intuition is that, if a training sample labelled by a function from some family can always be compressed, the family must in some sense have low complexity, and therefore be learnable.
     …  The set that the authors ultimately use in their work is the unit interval, which is the set of real numbers between 0 and 1. Their results imply that the finite subsets of the unit interval have monotone-compression schemes, and therefore are learnable in EMX, if and only if the continuum hypothesis is true, which is known to be unprovable.
     …  we do now know that we should be careful when introducing new models of learning.
     …  will bring to the field of machine learning a healthy dose of humility, even as machine-learning algorithms continue to revolutionize the world around us. /19-01-13

    Science 04 Jan 2019: Vol. 363, Issue 6422, pp. 78-80
    An elephant-sized Late Triassic synapsid with erect limbs
    Tomasz Sulej, Grzegorz Niedźwiedzki
    References (AW: nieważne gdzie się publikuje)
    64. M. Świło, thesis, Uniwersytet Wrocławski, Wrocław, 1–59 (2010)
    65. M. Świło, Znaleziska szczątków rekinów z Lipia Śląskiego. In Materiały z XXI Konferencji Naukowej Sekcji Paleontologicznej PTG „Kopalne biocenozy w czasie i przestrzeni”, Żarki-Letnisko, 84 (2010b)
    66. M. Świło, J. Kowalski, Mikroskamieniałości kręgowców z Lipia Śląskiego. In Materiały do III Konferencji „Młodzi w Paleontologii”, Instytut Botaniki PAN, Kraków, 42 (2011). /19-01-08

    The Beautiful Mind-Bending of Stanislaw Lem
     …  In his autobiographical essay “Chance and Order,” which appeared in The New Yorker, in 1984, Lem recalls how as an only child growing up in Lvov, Poland, he amused himself by creating passports, certificates, permits, government memos, and identification papers. Equipped with these eccentric toys,
     …  “Summa Technologiae,” from 1964 .. Thomas Aquinas, in his thirteenth century “Summa Theologica,”
     …  Alan Turing’s imitation game as imagined in his epochal 1950 essay, “Computing Machinery and Intelligence.”
     …  Lem of a poet of “scientific terminology” /19-01-07

    brain produces a continuous stream of unconscious predictions
     …  Freud
     …  human beings are driven by dark emotional forces over which they have little or no control
     …  the secret desires of the unconscious.
     …  Pixar film Inside Out .. hardly be less accurate
     …  conscious and the unconscious processes do not usually operate in opposition
     …  They are not even separate spheres, as Freud’s later classification into the ego, id and superego would suggest. Rather there is only one mind
     …  even our most reasonable thoughts and actions mainly result from automatic, unconscious processes.
     …  to function smoothly in the world, and becoming conscious when predictions fail
     …  ‘heaven is a place where nothing, nothing ever happens’? Well, that’s the brain’s preferred state because it is energy- and time-efficient.
     …  predictive errors equal surprise equals consciousness
     …  The autopilot in our brain—not consciousness—makes us what we are. /19-01-06

    The digital revolution isn’t over but has turned into something else
     …  George Dyson
     …  Nature uses digital coding for the storage, replication, recombination, and error correction of sequences of nucleotides, but relies on analog coding and analog computing for intelligence and control. No programming, no code. To those seeking true intelligence, autonomy, and control among machines, the domain of analog computing, not digital computing, is the place to look.
     …  Digital computing, intolerant of error or ambiguity, depends upon precise definitions and error correction at every step. Analog computing not only tolerates errors and ambiguities, but thrives on them.
     …  Digital computers, in a technical sense, are analog computers, so hardened against noise that they have lost their immunity to it.
     …  Analog computers embrace noise; a real-world neural network needing a certain level of noise to work.
     …  Their models are no longer models. The search engine is no longer a model of human knowledge, it is human knowledge.
     …  No one is at the controls.
     …  What deserves our full attention is not the success of a few companies that have harnessed the powers of hybrid analog/digital computing, but what is happening as these powers escape into the wild and consume the rest of the world.
     …  The next revolution will be the ascent of analog systems over which the dominion of digital programming comes to an end. Nature’s answer to those who sought to control nature through programmable machines is to allow us to build machines whose nature is beyond programmable control. /19-01-06

    Vaccines Cause Autism: The Lie That Never Dies
     …  A crucial and indisputable fact about the “vaccines cause autism” narrative is that it is founded on fraudulent research.
     …  lie was based upon only 12 children, but refuting this lie by disproving this fraudulent research required studies that now include literally millions of children.
     …  the actual cause of autism is not yet known.
     …  It is also instructive to study the proposed “causes” of Down Syndrome prior to 1959, when the actual cause became known. For example, there was considerable belief that “retroflection in the uterus” was a key cause. /19-01-06

    Infinity: New Research Frontiers   eds. Michael Heller, W. Hugh Woodin
    Introduction, Rudy Rucker:
     …  the starting point of the metaphysical notion of infinity is the notion of absolute indeterminacy. .. the metaphysical infinite is a domain in which the principle of noncontradiction fails, and both A and the negation of A can be true. .. things such as numbers, matter, space, or time can never really attain to a truly metaphysical infinitude. .. “We see here, then, that between the mathematical and the metaphysical senses of ‘infinite’ there exists not merely a distinction, but very nearly an opposition…any possible analogy is at best pictorial, affective, and immeasurably remote.”
     … ת = {ℵ0,...,ℵ1,...,ℵn}        (ת - Tav)
    This ת, Georg Cantor claimed, is God, the creative source of all quantities existing in the world, and an intuitive insight of God is possible. /19-01-01

    2018

    Earth science .. Anthropocene
    The broiler chicken as a signal of a human reconfigured biosphere
    Carys E. Bennett, Richard Thomas, Mark Williams, Jan Zalasiewicz, Matt Edgeworth, Holly Miller, Ben Coles, Alison Foster, Emily J. Burton and Upenyu Marume
    Changing patterns of human resource use and food consumption have profoundly impacted the Earth’s biosphere. Until now, no individual taxa have been suggested as distinct and characteristic new morphospecies representing this change. Here we show that the domestic broiler chicken is one such potential marker. Human-directed changes in breeding, diet and farming practices demonstrate at least a doubling in body size from the late medieval period to the present in domesticated chickens, and an up to fivefold increase in body mass since the mid-twentieth century. Moreover, the skeletal morphology, pathology, bone geochemistry and genetics of modern broilers are demonstrably different to those of their ancestors. Physical and numerical changes to chickens in the second half of the twentieth century, i.e. during the putative Anthropocene Epoch, have been the most dramatic, with large increases in individual bird growth rate and population sizes. Broiler chickens, now unable to survive without human intervention, have a combined mass exceeding that of all other birds on Earth; this novel morphotype symbolizes the unprecedented human reconfiguration of the Earth’s biosphere. /18-12-30

    AlphaZero .. a new age of insight
     …  Deep Blue could evaluate 200 million positions per second.
     …  it played like a machine, brutally and materialistically. It could out-compute Mr. Kasparov, but it couldn’t outthink him.
     …  Stockfish and Komodo, still play in this inhuman style.
     …  these chess “engines” have no real understanding of the game.
     …  tremendously fast and strong, but utterly lacking insight.
     …  All of that has changed with the rise of machine learning.
     …  AlphaZero discovered the principles of chess on its own and quickly became the best player ever.
     …  AlphaZero seemed to express insight. It played like no computer ever has, intuitively and beautifully, with a romantic, attacking style.
     …  In some games it paralyzed Stockfish and toyed with it.
     …  Grandmasters had never seen anything like it. AlphaZero had the finesse of a virtuoso and the power of a machine.
     …  an awesome new kind of intelligence.
     …  By discovering the principles of chess on its own, AlphaZero developed a style of play that “reflects the truth” about the game rather than “the priorities and prejudices of programmers,” Mr. Kasparov wrote
     …  machine learning could be applied to medical diagnosis.
     …  What is frustrating about machine learning, however, is that the algorithms can’t articulate what they’re thinking.
     …  AlphaInfinity
     …  For human mathematicians and scientists, this day would mark the dawn of a new era of insight.
     …  Suppose that deeper patterns exist to be discovered — in the ways genes are regulated or cancer progresses
     …  If AlphaInfinity could identify and understand them, it would seem to us like an oracle.
     …  AlphaInfinity could cure all our diseases, solve all our scientific problems and make all our other intellectual trains run on time. We did pretty well without much insight for the first 300,000 years or so of our existence as Homo sapiens.
     …  the golden era of human insight, this glorious interlude, a few thousand years long, between our uncomprehending past and our incomprehensible future. /18-12-29

    Albert Einstein’s God Letter
     …  Is there a God? Do I have free will?
     …  Religion vs Science debate
     …  Einstein did have views about God, but he was a physicist, not a moral philosopher
     …  “God does not play dice with the universe” is his best-known aperçu on the topic—he seems to have held a standard belief for a scientist of his generation.
     …  He regarded organized religion as a superstition, but he believed that, by means of scientific inquiry, a person might gain an insight into the exquisite rationality of the world’s structure, and he called this experience “cosmic religion.”
     …  “Cosmic religion” has nothing to do with morality or free will or sin and redemption.
     …  The reason that God does not play dice in Einstein’s universe is that physical laws are inexorable.
     …  there is no uncaused cause
     …  The only mystery is why there is something when there could be nothing.
     …  Einstein says that he is happy being a Jew, but that he sees nothing special about Jewishness.
     …  The word God, he says, is “nothing more than the expression and product of human weakness,” and the Hebrew Bible is a collection of “honorable, but still purely primitive legends.”
     …  The word that he uses is “primitiven”—that is, “primitive,” meaning pre-scientific.
     …  He is saying that it doesn’t matter what our religious or our philosophical commitments are. The only thing that matters is how we treat one another. /18-12-28

    Harari .. on the revolutionary impact of artificial intelligence.
     …  For the first time in history we have absolutely no idea how the world will look in 30 years.
     …  We trust the Google algorithm and we lose the ability to search for information independently.
     …  We should never underestimate human stupidity.
     …  any human emotion, are in the end just a biochemical process.
     …  almost all traffic accidents are because of humans making bad decisions.
     …  Hamlet just takes out his cellphone and asks Siri what to do?
     …  You make good decisions, you go to heaven. You make bad decisions, you go to hell.
     …  The liberal story is based on the ideal and the notion of free will, .. But science is now telling us there is no such thing as free will. It’s a myth.
     …  science doesn’t even understand the meaning of free will. We don’t know of any free processes in nature. We know only two types of processes in nature. We know of deterministic processes and random processes.
     …  randomness isn’t freedom
     …  Our desires are shaped by both nature and culture in ways that are beyond the understanding and control of individuals.
     …  of my free will, of my free spirit. But then you become the easiest person to hack and to manipulate.
     …  Most of the efforts give the government or corporations the ability to monitor us. But there is no technical problem in reversing the direction of the surveillance.
     …  three simple statements. Things are better than ever before. Things are still quite bad. Things can get much worse.
     …  Science and technology guarantee only one thing. And this thing is power. Humankind is going to become more powerful. /18-12-27

    Impossible Friendships

    For example, with someone who no longer is,
    who exists only in yellowed letters.

    Or long walks beside a stream,
    whose depths hold hidden

    porcelain cups—and the talks about philosophy
    with a timid student or the postman.

    A passerby with proud eyes
    whom you’ll never know.

    Friendship with this world, ever more perfect
    (if not for the salty smell of blood).

    The old man sipping coffee
    in St.-Lazare, who reminds you of someone.

    Faces flashing by
    in local trains—

    the happy faces of travelers headed perhaps
    for a splendid ball, or a beheading.

    And friendship with yourself
    —since after all you don’t know who you are.

    by Adam Zagajewski from Eternal Enemies, Farrar, Straus & Giroux, LLC, translated by Clare Cavanagh/3 Quarks Daily/18-12-23

    differences in the humanities and sciences .. intensified
     …  Developments in cognitive neuroscience and other fields — from sophisticated brain-imaging techniques to increasingly detailed knowledge of human genetics — promise to revolutionize our knowledge of human behavior.
     …  accuse the humanities of ignoring human nature
     …  we should use psychological findings to ameliorate built-in ethnocentric reflexes and enhance people’s openness to others
     …  Humanistic scholars should be interested in objective accounts of how the world works, especially insofar as the aggregate effects of human action outrun the beliefs and intentions of individuals. /18-12-22

    Portraits Made by AI: None of These People Exist
     …  Not in the sense that they were Photoshopped, but rather they were completely generated by artificial intelligence.
     …  generative adversarial network (GAN)
     …  NVIDIA researchers are now able to copy the “styles” of source faces onto destination faces, creating blends that have copied features but which look like entirely new people /18-12-22

    Coal and Consequences, Five Days in Katowice
     …  As the bus nears downtown Katowice .. a coal mine. There are fourteen in Katowice, although only two remain active.
     …  Many Katowicians still burn coal for heat.
     …  Spodek .. it look like a crashed flying saucer.
     …  a “rule book” for the landmark 2015 Paris Agreement.
     …  signatory nations can ignore it without any direct consequences.
     …  the most important annual conference on the most important perennial threat to my generation.
     …  Climate change is running; we were walking; we are now standing.
     …  Marcin Krupa .. Andres Duda .. Poland has enough coal reserves for over two hundred years
     …  “Gilets Jaunes” movement in France .. Habermas .. modern democracy is the interflux of communication between the political and civil society
     …  Arnold Schwarzenegger .. “I wish I could be the Terminator in real life and travel back in time to stop all fossil fuels from being discovered,” he says. Then he leaves.
     …  Sir David Attenborough .. “the destruction of our civilization is on the horizon”
     …  Katowice has coal.
     …  Duda .. visits a coal mine in Brzeszcze .. “Please, don’t worry. As long as I am the president, I won’t allow anyone to murder the Polish mining.”
     …  “Sustainaclaus”
     …  the pointlessness of the meeting
     …  CO2 emissions rose 2.7 percent in 2018—the largest increase in the past seven years.
     …  “My own Germany was reunified because of the bravery of the people in Poland.”
     …  a conference about limiting change rather than increasing it /18-12-17

    new neural network design could overcome big challenges in AI
     …  borrowed equations from calculus to redesign the core machinery of deep learning so it can model continuous processes
     …  Neural nets
     …  The discrete layers are what keep it from effectively modeling continuous processes
     …  it replaces the layers with calculus equations
     …  there are no more nodes and connections, just one continuous slab of computation
     …  ODE for “ordinary differential equations”
     …  The new method allows you to specify your desired accuracy first, and it will find the most efficient way to train itself within that margin of error. /18-12-17

    wealthiest people .. are getting ready for the crackup of civilization
     …  C.E.O. of Reddit .. arranged to have laser eye surgery .. not for the sake of convenience or appearance but, .. he hopes that it will improve his odds of surviving a disaster, whether natural or man-made .. getting contacts or glasses is going to be a huge pain in the ass
     …  in recent years survivalism has expanded to more affluent quarters, taking root in Silicon Valley and New York City
     …  “I keep a helicopter gassed up all the time, and I have an underground bunker with an air-filtration system.”
     …  Bitcoin and cryptocurrency
     …  W.R.O.L., “without rule of law.”
     …  contemporary life rests on a fragile consensus
     …  “How to Eat a Pine Tree to Survive”
     …  “Oh, are you going to get apocalypse insurance?”
     …  New Zealand, he discovered, is a favored refuge
     …  walls are fitted with L.E.D. “windows” that show a live video of the prairie above the silo
     …  One prospective resident from New York City wanted video of Central Park. “All four seasons, day and night,” Menosky said. “She wanted the sounds, the taxis and the honking horns.” /18-12-17

    Leszek Aleksander Moczulski
    W pewnym wieku, po człowieku.
    Jestem starczy, wystarczy.
    /Bronisław Maj w Dwójce, 18-12-14

    Harari, Youval Noah
    21 Lessons for the 21st Century
     …  We flesh-and-body mortals must take full responsibility for whatever we do - or don't do.
     …  Escaping the narrow definition of self might well become a necessary survival skill in the twenty-first century.
     …  So what should we be teaching? Many pedagogical experts argue that schools should switch to teaching ‘the four Cs’ – critical thinking, communication, collaboration and creativity. More broadly, schools should downplay technical skills and emphasise general- purpose life skills. Most important of all will be the ability to deal with change, to learn new things, and to preserve your mental balance in unfamiliar situations. In order to keep up with the world of 2050, you will need not merely to invent new ideas and products – you will above all need to reinvent yourself again and again.
     …  In the middle of town there is a large concrete building divided into many identical rooms, each room equipped with rows of desks and chairs. At the sound of a bell, you go to one of these rooms together with thirty other kids who were all born the same year as you. Every hour some grown- up walks in, and starts talking. They are all paid to do so by the government. One of them tells you about the shape of the earth, another tells you about the human past, and a third tells you about the human body. It is easy to laugh at this model, and almost everybody agrees that no matter its past achievements, it is now bankrupt. /18-11-30/18-12-09

    В письмах к Эйнштейну
     …  Франк стремился добитьсс от него публичного осуждении действий советской власти, надеесь, что оно будет способствовать прекращению репрессий.
     …  анализировал официальные источники (советские газеты) того времени и пытался показать Эйнштейну их политическую и идеологическую ангажированность, особенно при освещении громких судебных процессов.
    Вопросы философии. 2018 11/111-116 И. Оболевич, А.З. Цыганков /18-12-08

    Attenborough .. in Katowice
     …  "Right now, we're facing a man-made disaster of global scale," Attenborough told delegates from almost 200 nations. "Our greatest threat in thousands of years: climate change. If we don't take action, the collapse of our civilizations and the extinction of much of the natural world is on the horizon."
     …  "Leaders of the world, you must lead," Attenborough concluded. "The continuation of our civilizations and the natural world upon which we depend is in your hands." /18-12-07

    neurons .. representing the passage of time
     …  lateral entorhinal cortex, or L.E.C.
     …  the neurons in the L.E.C. are creating “timestamps” that record the order of unfolding events.
     …  It’s encoding ongoing experience.
     …  Take the same route to work every day, and the trips may blur in your mind.
     …  the two inputs “are mixed together,” a memory acquires a where and a when.
     …  our brains must have something like a “sense” of time
     …  “time” isn’t an absolute thing that our brains can “track” or “measure”; it’s more like an organizational system for making sense of change
     …  (Helpfully, physicists suggest that time may be an illusion.) /18-12-07

    neuroscience
     …  IBM’s Jeopardy winning computer Watson is a serious threat
     …  the advance of AI seems to pose a cultural threat
     …  Nobel Prize .. neuroscientists
     …  the human brain doesn’t work the way conscious experience suggests at all. Instead it operates to deliver human achievements in the way IBM’s Watson does. Thoughts with meaning have no more role in the human brain than in artificial intelligence.
     …  belief/desire pairings somewhere in our brains
     …  information about means
     …  we have an innate mind-reading ability more powerful than other primates. .. to track other people’s actions
     …  fMRI and transcranial magnetic stimulation studies have localized a brain region that delivers this mind-reading ability.
     …  powerful mind reading for the cooperation and collaboration that resulted in Hominin genus’s rapid ascent
     …  the theory of mind .. has no basis in what neuroscience tell us about how the brain works
     …  how brains record and store the information we mistakenly describe as beliefs about the world in which we find ourselves.
     …  It’s not giving the neural circuits content, treating them as containing statements about where the rat is. Experimenters decode firing patterns. Rats don’t. They ‘re just driven by them.
     …  What makes some neural firings into location-recorders and other firings into odor-recorders is just their place in the causal chain, the pathway to further behavior. Rats choose among alternative pathways as a result of neural firings produced by previous experience. But it’s not because these neuron circuits contain statements about anything. The neurons don’t represent to the rat the way it’s world is arranged. So they don’t work any thing like the way beliefs have to work, pairing up with desires via shred content about means and ends.
     …  physiological identities between the structure of rat and human brains
     …  ever since Freud psychologists have diagnosed the illusions, delusions and confabulations in the mind
     …  The theory of mind is just another one of these illusions, useful for survival and success in the Pleistocene
     …  our brains the neural circuits neither have nor need content to do their jobs
     …  Watson may beat us at Jeopardy, but we are convinced we have something AI will always lack: We are agents in the world, whose decisions, choices, actions are made meaningful by the content of the belief/desire pairings that bring them about. But what if the theory of mind that underwrites our distinctiveness is build on sand, is just another useful illusion foisted upon us by the Darwinian processes that got us here? Then it will turn out that neuroscience is a far greater threat to human distinctiveness than AI will ever be. /18-11-30

    Poland bans the publication of polls just before elections.
     …  Tomatoes (in Polish, POmidory) are code for the Civic Platform (PO), a centre-right party; red beetroots signify the Left Democratic Alliance.
     …  Most countries also ban electioneering on election day itself. Such embargoes are a joke.
     …  Poles have merrily tweeted about the “prices” of “products” that sound suspiciously like political parties since at least 2011. “PIStachios”
     …  Banning pre-election polls makes access to information less equal. Parties and big firms can pay for private surveys. Astute voters can sift for credible data via foreign websites or the betting markets. Other voters are unlikely to do any of these things. In the absence of reputable polls, bogus ones proliferate and mislead. Lifting the ban and letting pollsters poll seems wiser, and not just in Poland. /18-11-30

    Driverless Car
     …  Waymo .. Under a new name, the Google sibling plans to methodically build a futuristic rival to Uber and Lyft
     …  early December
     …  a test group of 400 volunteer families who have been riding Waymos for more than a year
     …  After all, there will still be some backup drivers, customers will have to wait to join, it will only operate in a tiny geographic area with ideal driving conditions, and it’s still years away from being a profitable, stand-alone business.
     …  62,000 plug-in hybrid Pacifica minivans and 20,000 fully-electric I-Pace SUVs
     …  The age-old guessing game of how long it will take for cars to drive themselves has come to an end. The better question now: How long will it take them to reach me? /18-11-21

    Why Is There Something, Rather Than Nothing?
     …  Sean M. Carroll in: arXiv.org Physics, History and Philosophy of Physics
     …  It seems natural to ask why the universe exists at all. Modern physics suggests that the universe can exist all by itself as a self-contained system, without anything external to create or sustain it. But there might not be an absolute answer to why it exists. I argue that any attempt to account for the existence of something rather than nothing must ultimately bottom out in a set of brute facts; the universe simply is, without ultimate cause or explanation.
     …  It was Leibniz .. Principle of Sufficient Reason
     …  God is the reason the universe exists, but God’s existence is its own reason, since God exists necessarily. .. Aristotle’s .. unmoved mover
     …  Hume .. and Kant [9] doubted that the intellectual tools we have developed to understand the world of experience could sensibly be extended to an explanation for existence itself.
     …  Bertrand Russell .. “I should say that the universe is just there, and that’s all,” .. Ludwig Wittgenstein .. we should remain silent: “It is not how things are in the world that is mystical, but that it exists.”
     …  The naturalness of the impulse to ask why the universe exists does not imply that the question is coherent or answerable.
     …  Our experience of the world, which is confined to an extraordinarily tiny fraction of reality
     …  the existence of the universe is unlikely to be the kind of thing that has a reason why.

     …  What Does “Why” Mean?
     …  Aristotle .. Modern physics sees things differently. Rather than being a story of effects and their associated causes, the universe is described by patterns, called the laws of physics, that relate conditions at different times and places to each other, typically by differential equations.
     …  While we don’t currently know the once-and-for-all laws of nature, nothing that we do currently understand about physics implies any necessary obstacle to thinking of the universe as a fully law-abiding, self-contained system.
     …  Perhaps it is the minimal imaginable universe, or the most symmetric
     …  The emergent nature of causality can be traced in part to the fact that the entropy of the universe was very low in the past
     …  explanatory regression: given any purported reason why reality exists, why is that reason valid?
     …  “Why is there something rather than nothing?”:
    • Creation: There is something apart from physical reality, which brings it into existence and/or sustains it. This hypothetical entity is often identified with God in the literature, but there is not necessarily any strong connection with a traditional theistic conception of the divine.
    • Metaverse: Just as we can sometimes explain events within the universe by appeal to a causal web describing the universe as a whole, perhaps what we think of as reality is part of a larger context, a metaverse that could help explain the existence and properties of our universe. (We’re imagining here something more profound than the traditional cosmological multiverse, which is just a universe in which conditions are very different in different regions of spacetime.)
    • Principle: There is something special about reality, in that it satisfies some underlying principle, perhaps of simplicity or beauty.
    • Coherence: Perhaps the concept of “nothingness” is incoherent, and the possibility of reality not existing was never actually a viable option.
    • Brute fact: Reality itself simply exists, in the way that it does, without further explanation.

     …  What Do “Something” and “Nothing” Mean?
     …  Why is there anything inside the universe, rather than just empty space? Why is there space at all? Why is there anything we would recognize as “a universe”? For the first question, the relevant notion of “nothing” is “empty space,” while for the second it is the non-existence of reality altogether.
     …  special relativity .. spacetime itself can begin or end .. there was such a singularity in the past
     …  quantum mechanics .. no consensus about what the ultimate ontology of quantum mechanics actually is
     …  a “vacuum,” defined as the lowest-energy state
     …  “empty space” isn’t quite the same as “nothing there.” Even in the emptiest lowest-energy state, there are still field degrees of freedom at every point in space
     …  Reeh–Schlieder theorem
     …  multiple kinds of vacua .. a true vacuum that is the lowest-energy state, and false vacua that have no particles in them, but whose energy density is higher than in the true vacuum.
     …  Due to the phenomenon of spontaneous symmetry breaking, the most symmetric vacuum (in which the expectation value of all the quantum fields vanishes) is generally not the true vacuum.
     …  nothing is unstable
     …  In the context of creation of something from nothing, we must also face the issue of “quantum fluctuations.”
     …  A quantum state is simply a quantum state, and a true vacuum state will be stationary, with nothing “fluctuating” at all.
     …  The situation diverges from our Newtonian intuition even more dramatically when we turn to quantum gravity, in which spacetime itself has a wave function.
     …  One consequence of quantum gravity is that the distinction between “empty space” and “space filled with stuff” is blurred, practically to invisibility.
     …  The best we can say is that our current incomplete understanding of quantum gravity is fully compatible with both the possibility that the universe has lasted forever, and that it had a first moment in time.

     …  The Possibility Question: Can the Universe Simply Be?
     …  whether physical reality requires something external to itself
     …  Schrödinger’s equation Ĥ | Ψ 〉 = iℏ ∂/∂t | Ψ 〉
     …  quantum states evolve eternally toward both the past and the future
     …  Ĥ|Ψ〉=0 .. If theWheeler-DeWitt equation is correct, it presents us with an immediate challenge, known as the “problem of time”: there is no time parameter in the equation, so what is “time” supposed to mean?
     …  time might be emergent, rather than fundamental
     …  if the universe doesn’t exist, there is no time, and hence there are no processes.
     …  The question is not whether a universe could pop into existence out of nothingness, but whether a universe with a beginning can be entirely described by an appropriate set of laws of physics without the help of any external cause.
     …  the notion of cause and effect as being appropriate to higher-level emergent descriptions of the world rather than the fundamental level
     …  a most perfect being, as the notion of “perfection” is not rigorously defined
     …  Hume emphasized, there is no being whose non-existence would entail a logical contradiction
     …  The idea of a universe created by a greater being, for some specific purpose or having some particular properties, seems somehow more satisfying than a universe that existed without a brute fact. (Our idea of satisfying explanations has, needless to say, been trained on our experience within a tiny fraction of reality, not on the existence of the whole of reality itself; but we work with what we have.)
     …  there is no logical or empirical reason why such an entity must exist; the universe can just be.

     …  The Naturalness Question: Why This Particular Universe?
     …  the universe and its laws of nature are the simplest that they could be, given .. the existence of intelligent observers.
     …  Perhaps .. all of the laws of physics applying to our universe can be encapsulated in a single succinct principle.
     …  “landscape” of physically realizable possibilities .. In string theory, estimates for the size of this landscape throw around numbers of the form 10500.
     …  anthropic principle
     …  the universe simply seems to have far more stuff in it than any reasonable anthropic criterion would imply; there are more than a trillion galaxies, with of order a hundred billion stars and planets in each of them, none of which is necessary for our existence here.
     …  the properties of our particular universe cannot be solely attributed to the fact that intelligent observers exist within it

     …  The Reason Question: Why Does Anything Exist at All?
    • Creation
     …  whatever reality is, it’s natural
     …  “laws of nature” are inexplicable in the absence of some entity that ensures those laws are obeyed .. we should be suspicious
     …  to explain the existence of a creator.
    • Metaverse
     …  Cosmologists use the word “multiverse” to refer to something that is actually more prosaic than it sounds: a single connected spacetime, but with regions (“universes”) where conditions are very different from each other.
     …  a collection of truly distinct realities (noninteracting, not stemming from a common past, not necessarily with the same laws of physics), one of which is our own.
     …  it does not directly provide an answer
    • Principle
     …  Perhaps our universe is the simplest subject to certain conditions, or perhaps all possible realities actually exist. Such an answer would again face the explanatory regression problem
    • Coherence
     …  “nothing exists” might not, despite the seeming naturalness of the formulation, actually be a coherent idea.
     …  what does “been” really mean in such a construction?
     …  perhaps the universe exists simply because there was no coherent alternative.
     …  Perhaps our language and modes of thought are tricking us
    • Brute fact
     …  In Kepler’s time, the question of why there were precisely six planets .. was a natural one to ask
     …  We are always welcome to look for deeper meanings and explanations. What we can’t do is demand of the universe that there be something we humans would recognize as a satisfactory reason for its existence.
    /18-11-15

    what makes us human
     …  ancient DNA in reshaping understanding of how Homo sapiens came to be and to act like modern humans
     …  The Mind Brain Behavior (MBB)
     …  new understanding of the migrations and intermingling that brought about modern humanity
     …  species and ancestral group overlap and blur at the edges
     …  the ancestors of humans and modern chimpanzees interbred for perhaps millions of years after the two lineages had split
     …  can scientists pinpoint the genes that enabled humans, unlike other species, to create art, tools, and eventually civilization?
     …  many of humanity’s behavioral calling cards .. became rapidly widespread about 50,000 years ago. .. explosive spread of these behaviors, defining modern humanity.
     …  50,000-year-old genetic switch
     …  the lineages of modern humans probably diverged about 300,000 years ago, well before this “human revolution.” Some “modern” behaviors are spread even wider, since Neanderthals—who diverged from Homo sapiens some 700,000 years ago—show a surprising knack for art and ornamentation.
     …  if human behavior didn’t arise from rapid genetic change, but rather from cultural transmission, it indicates something more profound than any “human” gene: modern humanity was not evolved, but invented.
     …  David Reich /18-11-14

    classical music .. followed laws of evolution
     …  to look at unique musical features such as the tritone–a dissonant interval of three whole notes–and measure the number of occurrences in Western musical compositions over the centuries.
     …  The mean and standard deviation of the frequency (probability) of tritones steadily increased during the years 1500-1900.
     …  involves carrying on some traditions from the past .. At the same time, musicians intermittently introduce new features to capture listeners’ interest.
     …  model can be used to analyze this balance between typicality and novelty
     …  aesthetic parasite .. aesthetic parasite
     …  Humans may have sung even before we spoke using syntax.
     …  Music, like food ingestion, is rooted in biology
     …  rather than a by-product of evolution, music or more precisely musicality is likely to be a characteristic that survived natural selection in order to stimulate and develop our mental faculties
     …  AI programmers will try to game the system by looking at examples of novelty .. and trying to “evolve” their music /18-11-14

    gut bacteria .. our brains
     …  the menagerie of microbes in the gut has powerful effects on our health
     …  penetrating and inhabiting the cells of healthy human brains
     …  It’s like a whole new molecular factory [in the brain] with its own needs.
     …  might affect mood and behavior
     …  unexpectedly intimate relationship between microbes and the brain
     …  they might play a key role in regulating the brain’s immune activity. /18-11-14

    Zginiemy?
     …  jest bardzo prawdopodobne
     …  Wnuki? – Jeszcze nie, ale mam nadzieję ... Znaczy, patrząc z perspektywy zwyczajnoludzkiej, bo tak poza tym to ostatnio zacząłem się zastanawiać, czy to w ogóle ma sens.
     …  bardzo mało używam samochodu. A jak już, to staram się jeździć z kimś, a najlepiej w kilka osób.
     …  ograniczyłem mięso /18-11-12, Nauka o Klimacie

    A.I., Is Seeing Still Believing?
     …  surveillance camera’s “imaging pipeline”—the lens, the sensor, the compression algorithms—its data had been “downsampled,” and, in the end, very little information remained.
     …  the degradation of the image couldn’t be reversed
     …  neural networks .. to analyze and create images and videos
     …  expert systems capable of producing realism on a vast scale.
     …  “Synthesizing Obama”
     …  smartphones digitally manipulate even ordinary snapshots, often using neural networks
     …  unreal images, if they are realistic enough, can lead to the truth.
     …  anybody could buy Photoshop. But to really use it well you had to be highly skilled,” Farid said. “Now the technology is democratizing.”
     …  “Why did Stalin airbrush those people out of those photographs?”
     …  We’re incredibly visual beings.
     …  Adobe Photoshop called “content-aware fill”: you can delete someone from a pile of leaves, and new leaves will seamlessly fill in the gap.
     …  Your Facebook news feed highlights what “people like you” want to see. In addition to unearthing similarities, social media creates them.
     …  patterns spread and outputs are recirculated as inputs
     …  you possessed an image of a landscape taken on a sunny day. You might want to know what it would look like in the rain.
     …  neural networks train other networks—an arrangement that researchers call a “generative adversarial network,” or GAN.
     …  synthesis of events that didn’t happen.
     …  if you can spot it, you can fix it
     …  “Digital Forensics in a Post-Truth Age”
     …  ‘zero trust’ model, where by default you believe nothing. That could be a difficult thing to recover from.”
     …  Body cameras may still capture what really happened, but the aesthetic of the body camera—its claim to authenticity—is also a vector for misinformation. “Eyewitness video” becomes an oxymoron. The path toward reality begins to wash away.
     …  a new kind of photograph—a verifiable digital original.
     …  We look at geolocation data, at the nearby cell towers, at the barometric-pressure sensor on the phone, and verify that everything matches.
     …  If the image passes muster, it’s entered into the Bitcoin and Ethereum blockchain.
     …  if it’s a choice between surveillance and synthesis, many people may prefer to be surveilled.
     …  if we humans were evolutionarily predisposed to jump to conclusions that confirmed our own views—the epistemic equivalent of content-aware fill.
     …  The generator tries to make it look real, but it can look real in different ways /18-11-11

    The Financial Crash and the Climate Crisis
     …  Ten years after the financial crash of 2008, the economy is humming along, with steady growth and rising employment. Yet that crisis continues to shape our world, particularly with the rise of right-wing populism and the ever-worsening climate crisis.
     …  explain why short-term thinking rules the day
     …  carbon tax /18-11-11

    Extinction on demand
     …  In 1980 Variola, the smallpox virus, was exterminated from the wild.
     …  mosquitoes that spread malaria, a second of humankind’s
     …  Gene drives can in principle be used against any creatures which reproduce sexually with short generations and aren’t too rooted to a single spot.
     …  the enthusiasm is not universal .. irreversible effects on ecosystems
     …  playing God
     …  crispr-Cas9
     …  Using sterile insects to control disease
     …  2026 as a possible date for trials that involve a release in the wild
     …  over 3,000 mosquito species
     …  Current gene drives are self-driving: the cutting mechanism and the thing that gets spread are one and the same. /18-11-08

    UN Says Climate Genocide Is Coming. It’s Actually Worse Than That.
     …  Report
     …  thorough transformation of the world’s economy, agriculture, and culture that “there is no documented historical precedent.”
     …  What has been called a genocidal level of warming is already our inevitable future.
     …  Human experience and memory offers no good analogy for how we should think about those thresholds
     …  raising the cost of a ton of carbon possibly as high $5,000 by 2030, a price they suggest may have to grow to $27,000 per ton by 2100.
     …  a carbon tax is only a spark to action, not action itself. And the action needed is at a scale and a speed almost unimaginable to most of us.
     …  one precedent, in all of human history, citing the model of how the United States prepared for World War II
     …  the last 25 years, since Al Gore published his first book on climate change. Monday’s IPCC may seem like a dramatic departure, and it is. /18-10-22

    recognise an alien
     …  a photo of an alien would be convincing evidence
     …  What is it that we’d see that would tell us we weren’t just looking at another pile of rocks?
     …  Living things .. have vast numbers of intricate parts working together
     …  The most beautiful natural rock formations lack even a tiny fraction of the myriad parts of a single bacterial cell
     …  to do things – eat, grow, survive, reproduce.
     …  combination of complex design and apparent purpose
     …  an exciting alien – design .. there’s only one way to get such design: natural selection.
     …  an organism cannot be designed for anything other than contributing genes to future generations.
     …  organisms are selfish
     …  a bee can sacrifice for the queen (its mother), if it means she’ll produce 100 more sisters, each carrying half the bee’s genes.
     …  design without a designer
     …  Even a postorganic, computer-based alien would ultimately be the product of a product of natural selection. /18-10-22

    Mathematical ideas
     …  Martin Heidegger .. an influential thinker who misrepresented mathematics
     …  a desire to bypass repetitious exercises is precisely one of the things that motivates mathematicians.
     …  proofs are nothing if not ways to think about something in all applicable cases so that repetitive testing on each possibility is not necessary. /18-10-22

    Self-Driving Cars Are Coming
     …  some level of self-driving technology
     …  six levels: 0 Automation: None .. 1 Driver Assistance .. 2 Partial .. 3 Conditional .. 4 High .. 5 Full
     …  level 4 designs might still include a steering column and pedals, in level 5 cars and trucks those features would be unnecessary
     …  Waymo, General Motors (GM), Daimler-Bosch, and Ford .. Waymo, owned by Google parent Alphabet is the clear leader .. over 8 million miles on public roads testing
     …  In theory, reaching a fully autonomous transposition system would have a tremendous impact on overall safety, specifically from reducing the human factor
     …  low volumes of personal, self-driving vehicles rolling out in the mid-2020’s with a more substantial amount coming by 2030.
     …  the economies of scale, .. the idea of autonomous vehicles will in fact work, .. what’s next? /18-10-10

    History Of The Whole World YouTube/18-09-30

    Kwantowe ekscytacje
    Z zachwytem przeczytałem w „PAUzie Akademickiej” 435 wiadomość, iż nauka polska zrodziła perłę najczystszą, klejnot przedziwnej urody, w postaci dzieła wprowadzającego fizykę kwantową do psychologii, a w szczególności do resocjalizacji i reedukacji przestępców, dzięki czemu proces ten, z którym – jak dotąd – nasz wymiar sprawiedliwości kiepsko sobie radzi, stanie się radykalnie skuteczniejszy. Zarówno autor książki przedstawiającej tę ideę oraz wspierający ją recenzenci pracują w Polsce (a nie na jakimś zachodnim uniwersytecie), można zatem bez wahania uznać to dzieło za największe osiągnięcie nauki ojczystej w ostatnich latach. Teraz trzeba tylko, by kompetentny tłumacz udostępnił je uczonym i rządom na całym świecie.
    Doceniając wielkość i oryginalność idei trzeba jednak powiedzieć, że profesor Rudowski nie jest pierwszym, ani jedynym, który mechanikę kwantową twórczo stosuje w tych przestrzeniach myśli ludzkiej, do których samym fizykom na myśl nie przyszło by sięgać. Kilka lat temu moja powinowata, studentka architektury w Wiedniu, pisała pracę magisterską pod kierunkiem jednego z tamtejszych profesorów. Uczony ów, specjalista od urbanistyki i architektury krajobrazu, lansował pomysł, by przestrzeń miejską kształtować za pomocą fizyki kwantowej. Niestety jego dzieła, pisane po niemiecku, były mi niedostępne. Przypuszczam, że koncepcja kwantowego miasta jest nieco mniej śmiała, twórcza i rewolucyjna niż kwantowa pieriekowka dusz (na początek tylko kryminalistów) w wizji profesora UW, tym niemniej każdy winien czuć podziw dla rozmachu jego myśli. Poproszony o pomoc, usunąłem z pracy tego dziewczęcia wszystkie fałszywe stwierdzenia dotyczące samej mechaniki kwantowej, natomiast w ogóle nie ingerowałem w propozycje kwantowego formowania przestrzeni mieszkalnej. Zapewne tylko konserwatyzm, strach przed wielką ideą i zwykła ludzka zawiść sprawiły, że do dziś Wiedeń nie może chlubić się pięknem kwantowej dzielnicy mieszkaniowej.
    Co jest w mechanice kwantowej, że tak ekscytuje ludzi?
    Leszek M. Sokołowski, Obserwatorium Astronomiczne UJ /PAUza Akademicka/18-09-28

    A Warning From Europe: The Worst Is Yet to Come. Polarization. Conspiracy theories. Attacks on the free press. An obsession with loyalty. Recent events in the United States follow a pattern Europeans know all too well.
     …  Is democracy dying?
     …  Telewizja Polska .. anti-Polish forces seek to blame Poland for Auschwitz
     …  a progovernment, Catholic-conspiratorial radio station called Radio Maryja.
     …  the illiberal one-party state, now found all over the world—think of China, Venezuela, Zimbabwe—was first developed by Lenin, in Russia, starting in 1917.
     …  Unlike Marxism, the Leninist one-party state is not a philosophy. It is a mechanism for holding power.
     …  but in modern Britain, America, Germany, France, and until recently Poland, we have assumed that competition is the most just and efficient way to distribute power.
     …  In Europe, two such illiberal parties are now in power: Law and Justice, in Poland, and Viktor Orbán’s Fidesz party, in Hungary.
     …  The Polish foreign service also wants to drop its requirement that diplomats know two foreign languages, a bar that was too high for favored candidates to meet.*
     …  nepotism, state capture
     …  Kaczyński
     …  Ciemny lud to kupi
     …  in Poland, and in Hungary too, we now have examples of what happens when a Medium-Size Lie—a conspiracy theory—is propagated first by a political party as the central plank of its election campaign, and then by a ruling party, with the full force of a modern, centralized state apparatus behind it.
     …  Smolensk conspiracy theory
     …  After the president had a brief phone call with his brother, his advisers apparently pressed the pilots to land.
     …  Like the Polish government, the Hungarian state promotes a Medium-Size Lie .. George Soros
     …  Polarization is normal. Skepticism about liberal democracy is normal. And the appeal of authoritarianism is eternal. /The Atlantic/18-09-26

    custom playlists for users based on DNA
     …  More than 15 million people have now traded their spit for insights into their family history.
     …  making DNA out to be far more important in our cultural identities than it is, in order to sell more stuff.
     …  what it means to get a surprise result of, say, 15 percent German. If you speak no German, celebrate no German traditions, have never cooked German food, and know no Germans, what connection is there, really? Cultural identity is the sum total of all of these experiences. DNA alone does not supersede it.
     …  DNA-testing companies are careful not to use racial categories
     …  a trip around the world to visit the places revealed in the DNA test .. a travel website /18-09-26

    Thomas Kuhn Kill Truth
     …  The Structure of Scientific Revolutions .. paradigm shifts
     …  scientific theories from before and after a scientific revolution cannot be compared in a straightforward way; they are “incommensurable”
     …  there isn’t any such thing as absolute progress
     …  Kuhn’s skepticism .. is poisonous
     …  mathematical notion of incommensurability .. the sides and the diagonal of a square
     …  Hippasus’ upending of conventional math is like a paradigm shift that the guardians of the old paradigm tried to prevent by killing him?
     …  no coherent reading of Kuhn’s philosophy
     …  Kuhnians, those truth-deniers, are easy marks for Nazis.
     …  a line from Kuhn to .. Donald Trump
     …  Kuhn’s strange insistence that changes in scientific paradigms change not only the way scientists investigate the world, but the very world itself.
     …  “at the heart of Kripke’s work” is that “language is not just about us and our thoughts; it directly — unmediated by our opinions and beliefs — connects us with the world.”
     …  Kant .. “3 + 5 = 8” is true a priori
     …  Kripke .. possible worlds
     …  Kuhn calls his final view “a sort of post-Darwinian Kantianism.”
     …  biological evolution could provide a model for the development of science. The diversification of living things into different species, each with a specialized environmental niche, has an analogue in the diversification of science into narrowly specialized fields. And much as organisms from different species are unable to interbreed, the specialized lexicons of different scientific fields make it ever more challenging for different scientific specialists to understand one another.
     …  “Like the Kantian categories, the lexicon” .. “supplies preconditions of possible experience.”
     …  Kuhn .. as a relativist, full stop; but this isn’t quite right. Kuhn admits there’s something objectively out there.
     …  “The ways of being-in-the-world which a lexicon provides are not candidates for true/false.” This is a “coherence theory” of truth /18-09-24

    scientists is studying science itself
     …  the realization that science isn't always the rigorous, objective search for knowledge it is supposed to be.
     …  “journalology”
     …  establishing reporting standards to the recent push to make study data freely available for others to explore
     …  Metaresearchers sometimes need a thick skin; not all scientists are grateful when their long-standing practices are questioned.
     …  If we understand better what we're doing, we might be able to do it better. /18-09-23

    Epic Proof of ABC Conjecture
     …  more than 500 pages, are written in an impenetrable style, and refer back to a further 500 pages or so of previous work by Mochizuki
     …  a + b = c. The three numbers a, b and c are supposed to be positive integers, and they are not allowed to share any common prime factors — so, for example, we could consider the equation 8 + 9 = 17, or 5 + 16 = 21, but not 6 + 9 = 15, since 6, 9 and 15 are all divisible by 3.
     …  5 + 16 = 21, our primes are 5, 2, 3 and 7. Multiplying these together produces 210, a much larger number than any of the numbers in the original equation. By contrast, for the equation 5 + 27 = 32, whose primes are 5, 3 and 2, the prime product is 30 — a smaller number than the 32
     …  I think the abc conjecture is still open. Anybody has a chance of proving it.
     …  No expert who claims to understand the arguments has succeeded in explaining them to any of the (very many) experts who remain mystified.
     …  I think this should not be considered a proof until Mochizuki does some very substantial revisions and explains this key step much better. /18-09-23

    Music
     …  the flow and shape of a tune that encourages you to predict its direction and follow along? Or is it that the lyrics
     …  the melody is so familiar
     …  explanatory mechanisms for musical pleasure
     …  Aristotle .. the tones of a melody could work together with a text in order to imitate the natural world.
     …  soundtrack
     …  18th-century .. music was naturally disposed to imitate the sounds of the emotions.
     …  a melody as a distant echo of something more primal
     …  indefiniteness and open-endedness of musical representation .. Diderot in 1751, ‘poetry describes it, but music only excites an idea of it
     …  It’s enjoyable to create meanings out of the abstract energy of musical performances.
     …  Imitation in fugues is not of nature, but instead of the fugue subject itself.
     …  the inability to track the unfurling of all the intricate and interlacing lines of a Bach fugue has the capacity to generate the melancholic awe and subsequent pleasure associated with what the German philosopher Immanuel Kant in 1764 called the mathematical sublime.
     …  musical complexity a potential for the experience of limitlessness.
     …  The pleasure of listening to music .. arises from the intellectual satisfaction that derives from attempting to follow the compositional design of a piece.
     …  intellectual flux and reflux
     …  It is precisely our difficulty in interpreting music that affords our pleasure as listeners
     …  Langer .. music .. is an ‘unconsummated symbol’, meaning that its significance is implied rather than being fixed. /18-09-08

    Profesor Tomasz Rudowski
     …  z Wydziału Stosowanych Nauk Społecznych i Resocjalizacji Uniwersytetu Warszawskiego opublikował dzieło naukowe pt. Resocjalizacja przez sztukę sakralną w kontekście psychologii kwantowej
     …  "Fizycy kwantowi udowodnili, że rozwój świadomości od- bywa się nie tyle na drodze ewolucji Darwina, co reinkarnacji myślenia w polu kwantowej świadomości"
     …  "Zgodnie z fizyką kwantową... daje się wykreślić hipotetyczne krzywe będące falami odpowiadającymi wierze i nadziei w przestrzeni"
     …  IWO BIAŁYNICKI-BIRULA i ŁUKASZ A. TURSKI, PAUza Akademicka 6 września /18-09-07

    math can teach us about finding order in our chaotic lives
     …  we search for a pattern that eliminates some of the chaos.
     …  if there were a computer that would simply calculate the Kolmogorov complexity of any string? .. computer tools like AI, deep learning, big data, quantum computing, etc., it would be easy to create such a computer.
     …  the Kolmogorov complexity of a string cannot be computed.
     …  While a computer might find some pattern in a string, it cannot find the best pattern.
     …  We will simply never know if the pattern that we have found is the best one.
     …  But that makes the search eternally interesting. .. something is interesting if it demands more thought.
     …  We want to know that there is some meaning, purpose, and significance in the world around us.
     …  We are biologically programmed to find some patterns that explain what they see.
     …  Really good literature .. leaves us with the possibility of many interpretations. We come face to face with the incomputability of the Kolmogorov complexity. /18-09-02

    The End of Theoretical Physics
     …  That we are able to write down natural laws in mathematical form at all means that the laws we deal with are simple — much simpler than those of other scientific disciplines.
     …  actually solving those equations is often not so simple.
     …  not from more sophisticated math but from more computing power.
     …  quantum behavior of space and time itself
     …  a quantum simulation to study so-called spin networks, structures that, in some theories, constitute the fundamental fabric of space-time.
     …  to simulate the information processing of black holes with ultracold atom gases.
     …  This line of research raises some big questions. First of all, if we can simulate what we now believe to be fundamental by using composite quasiparticles, then maybe what we currently think of as fundamental — space and time and the 25 particles that make up the Standard Model of particle physics — is made up of an underlying structure, too.
     …  With quantum simulations, the mathematical model is of secondary relevance.
     …  experimentalists will just learn which system maps to which other system /18-08-31

    Edit a human
     …  Jennifer Doudna
     …  This story begins nearly four billion years ago
     …  A long stringy molecule found a way to copy itself.
     …  tiniest increments generation after generation .. mutations .. to be stronger, faster, fly
     …  this process has led one particular organism – us – to grow large brains
     …  to shrink evolutionary time .. to manipulate the blind stumblings of random mutations
     …  Humans had advanced so far that we were finally able to control our own evolution.
     …  CRISPR-Cas9
     …  a conference of 500 ethicists, scientists and lawyers in 2015
     …  The labs in China had destroyed the embryos .. Far sooner than predicted, a threshold had been crossed.
     …  Clustered Regularly Interspersed Palindromic Repeats, or CRISPR (pronounced “crisper”)
     …  CRISPR might do more than make yogurt cheaper
     …  Eventually, a CRISPR baby will be born. The technology is too easy. There is no world government to stop its use; many argue no one should do so anyway. At the point that baby emerges, perhaps modified to evade a particular disease or perhaps even to look a particular way, theoretical debates will become real.
     …  Every week a new paper is published finding more genes that influence looks, intelligence, stamina, even sexuality.
     …  say, ‘I want my kid to be this tall, have this colour of eye, this level of IQ,’ and all those sorts of things. I think that would be terrible.
     …  that chapter is just beginning. /18-08-30

    antimatter
     …  observed the Lyman-alpha electronic transition in the antihydrogen atom
     …  Finding any slight difference between the behaviour of antimatter and matter would rock the foundations of the Standard Model of particle physics and perhaps cast light on why the universe is made up almost entirely of matter, even though equal amounts of antimatter should have been produced in the Big Bang.
     …  ALPHA .. CERN /18-08-30

    evolutionary psychological science
     …  Darwin’s ideas to issues of behavior, stood up, smiled at the rain, and pushed forward.
     …  The evolutionary perspective allows you to think about any and all psychological phenomena in a broader perspective.
     …  Humans are disgusted by stimuli that have the capacity to decrease the probability of survival and/or reproductive success.
     …  Obesity and resultant health issues such as cardiac disease are largely the result of an evolutionary mismatch between ancestral food offerings compared with modern, highly unnatural food offerings
     …  Large-scale politics are a mess partly because the human mind only evolved to deal with small-scale politics
     …  The evolutionary perspective has cracked the code on love in humans
     …  evolutionary psychology is a superpower. /18-08-29

    new brain cell found in people
     …  a dense, bushy bundle that is present in people but seems to be missing in mice.
     …  uppermost layer of the cortex
     …  raises the question of whether these neurons are key to certain brain functions that separate us from mice. /18-08-29

    Genes Refract Chance
     …  23andMe .. technology, contra astrology
     …  who I am
     …  This disproves genetic determinism in a strict—but not in a loose—sense.
     …  understanding the outcomes of particular gene-environment interactions are nothing but life-changing /18-08-27

    Democracy” means that they people rule, while “liberal” (in this sense) means that the rights of individuals are protected, even if they’re not part of the majority. Recent years have seen the rise of an authoritarian/populist political movement in many Western democracies, one that scapegoats minorities in the name of the true “will of the people.”
     …  liberal democracy could ultimately fail even in as stable a country as the United States.
     …  Yascha Mounk /18-08-26

    Neanderthals, Denisovans and modern humans interbred, at least a few times.
     …  Hybrids may not have been all that uncommon.
     …  when they met they seemed to not have prejudices against each other and mixed freely
     …  Modern humans lived in bigger, denser groups than Neanderthals or Denisovans, and they moved quickly across Europe and Asia. /18-08-26

    The idea of free information is extremely dangerous
     …  Yuval Noah Harari
     …  the long-term past of humankind and the long-term future
     …  we are heading towards a full-scale arms race of artificial intelligence, which is very, very bad news.
     …  Liberalism is based on the assumption that you have privileged access to your own inner world of feelings and thoughts and choices, and nobody outside you can really understand you. This is why your feelings are the highest authority in your life and also in politics and economics – the voter knows best, the customer is always right. Even though neuroscience shows us that there is no such thing as free will, in practical terms it made sense because nobody could understand and manipulate your innermost feelings. But now the merger of biotech and infotech in neuroscience and the ability to gather enormous amounts of data on each individual and process them effectively means we are very close to the point where an external system can understand your feelings better than you. We’ve already seen a glimpse of it in the last epidemic of fake news.
     …  The more people believe in free will, that their feelings represent some mystical spiritual capacity, the easier it is to manipulate them
     …  There is no penalty for creating a sensational story that is not true.
     …  whether we have the psychological resilience to sustain such a level of change /18-08-09

    Unreality of the Quantum World
     …  Wheeler .. elementary quantum phenomena are not real until observed .. anti-realism.
     …  Mach-Zehnder interferometer
     …  The Delayed-Choice Experiment
     …  to avoid retro-causality is to deny the photon any intrinsic reality and argue that the photon becomes real only upon measurement.
     …  Causal modeling involves establishing cause-and-effect relationships between various elements of an experiment.
     …  A hidden variable, in this context, is something that’s absent from standard quantum mechanics but that influences the photon’s behavior in some way.
     …  the first phase shift can take one of three values, and the second one of two values. That makes six possible experimental settings
     …  all three showed that the formula is greater than zero with irrefutable statistical significance. They ruled out the classical causal models of the kind that can explain Wheeler’s delayed-choice experiment.
     …  the most popular hidden variable theory remains unaffected by these experiments. The de Broglie-Bohm theory, a deterministic and realistic alternative to standard quantum mechanics, is perfectly capable of explaining the delayed-choice experiment. In this theory, particles always have positions (which are the hidden variables), and hence have objective reality, but they are guided by a wave. So reality is both wave and particle.
     …  quantum random-number generator
     …  source of randomness using photons coming from distant quasars, some from more than halfway across the universe. /18-07-31

    neurons in fruit-fly brain
     …  3D image of a fruit fly’s brain that’s so detailed, researchers can trace connections between neurons across the entire organ.
     …  to completely understanding fruit-fly behaviour. /18-07-24

    Is Poland Retreating from Democracy?
     …  A debate about the country’s past has revealed sharply divergent views of its future.
     …  Elisabeth Zerofsky
     …  up to three years in prison for any false claim that “the Polish Nation or the Republic of Poland is responsible or co-responsible for Nazi crimes committed by the Third Reich.”
     …  Anna Azari, said that the law could be seen as criminalizing Holocaust survivors
     …  There were no Polish units working under the Waffen S.S., as was the case with Dutch, Norwegian, and Estonian units.
     …  Warsaw suffered like no other European capital during the war.
     …  Catherine the Great, wrote that Poland was the home of “chaos,” “barbarity,” and “fanaticism.” For hundreds of years, Poland’s German and Russian neighbors had depicted Poland as backward and unenlightened, deserving of invasion.
     …  A few days after my meeting with Nowak, I looked up Comey’s speech. Nowak is a careful speaker, so I was surprised to find that what he’d told me wasn’t entirely true. In his address, Comey said that he asked every F.B.I. special agent he hired to visit the Holocaust Museum, in order to understand the human propensity for moral surrender. “In their minds,” Comey said, “the murderers and accomplices of Germany, and Poland, and Hungary, and so many, many other places, didn’t do something evil. They convinced themselves it was the right thing to do.”
     …  In the summer of 2017, the sociologist Maciej Gdula interviewed Law and Justice supporters from a provincial town not far from Warsaw, many of whom had benefitted greatly from the economic boom. Still, they felt despised by Polish élites. Kaczyński, they thought, offered a vision in which “you no longer have to go to university, get a mortgage and buy a flat, and declare that you have ‘European values,’ in order to be a fully-fledged member of the Polish nation,” as one reviewer of Gdula’s book, “The New Authoritarianism,” put it.
     …  Kaczyński said that accepting refugees would “completely change our culture and radically lower the level of safety in our country.” That year, however, Poland took in the second-highest number of immigrants in the E.U., mostly from Ukraine.
     …  Kaczyński rarely speaks to foreign media.
     …  Jarosław has never married, and lived with his mother until her death, in 2013. Now he lives with his cats. He opened a bank account for the first time in 2009, does not have a driver’s license, and prefers to eat alone. A person who knows Kaczyński told me that, since the death of his brother, he has acted without the check on his decisions that Lech used to provide.
     …  Kaczyński’s relationship with Rydzyk is strategic
     …  Adam Michnik .. most influential liberal newspaper, Gazeta Wyborcza, told me that he worried about a “creeping coup d’état that is transforming Poland into a Putinist-type state.”
     …  the percentage of people who think that Poles suffered as much as Jews during the war rose from thirty-nine in 1992 to sixty-two in 2012.
     …  “Hate speech is more and more accepted by this government,” Suchanow told me. A few weeks after the Cursed Soldiers demonstration, neo-Nazis marched through Warsaw, some wearing the S.S. insignia, which is illegal in Poland; the police protected them against far-left counterprotesters.
     …  A revolution .. whether it was a conservative one or a nationalist one /The New Yorker/18-07-24

    Obama
     …  During the last decades of the twentieth century, the progressive, democratic vision that Nelson Mandela represented in many ways set the terms of international political debate.
     …  A respect for human rights and the rule of law,
     …  the entry of China into the world’s system of trade
     …  Even when those human rights were violated, those who violated human rights were on the defensive.
     …  Suddenly a billion people were lifted out of poverty,
     …  all that progress is real.
     …  And while globalization and technology
     …  an explosion in economic inequality.
     …  many titans of industry and finance are increasingly detached from any single locale or nation-state
     …  shifting profits to a tax haven with the help of high-priced accountants or lawyers, or their decision to take advantage of lower-cost immigrant labor, .. it’s just a rational response,
     …  while some Western commentators were declaring the end of history
     …  most violently with 9/11
     …  Within the United States, within the European Union, challenges to globalization first came from the left but then came more forcefully from the right
     …  populist movements—which, by the way, are often cynically funded by right-wing billionaires
     …  I am not being alarmist. I am simply stating the facts. Look around.
     …  authoritarian control, combined with mercantilist capitalism
     …  Who needs free speech, as long as the economy is going good?
     …  Social media—once seen as a mechanism to promote knowledge and understanding and solidarity—has proved to be just as effective promoting hatred and paranoia and propaganda and conspiracy theories.
     …  Two different narratives about who we are and who we should be.
     …  Where might makes right, and politics is a hostile competition between tribes and races and religions, and nations compete in a zero-sum game, constantly teetering on the edge of conflict until full-blown war breaks out? Is that what we think?
     …  I believe in Nelson Mandela’s vision. I believe in a vision shared by Gandhi and King and Abraham Lincoln.
     …  we have no choice but to move forward
     …  The fact that authoritarian governments have been shown, time and time again, to breed corruption, because they’re not accountable; to repress their people; to lose touch eventually with reality; to engage in bigger and bigger lies that ultimately result in economic and political and cultural and scientific stagnation. Look at history. Look at the facts.
     …  of tribal, racial, or religious superiority as their main organizing principle
     …  The fact that technology cannot be put back in a bottle
     …  Now, I don’t believe in economic determinism. Human beings don’t live on bread alone.
     …  measuring their well-being by how they compare to their neighbors, and whether their children can expect to live a better life.
     …  not involve unregulated, unbridled, unethical capitalism.
     …  Sustainable Development Goals
     …  artificial intelligence is here, and it is accelerating
     …  universal income .. work week
     …  the French football team that just won the World Cup. Because not all of those folks look like Gauls to me. But they’re French. They’re French.
     …  newcomers should make an effort to adapt to the language and customs of their new home. Those are legitimate things,
     …  democracy is about more than just elections
     …  No individual—not Mandela, not Obama—are entirely immune to the corrupting influences of absolute power
     …  We have to stop pretending that countries that just hold an election where sometimes the winner somehow magically gets ninety per cent of the vote
     …  the efficiency that’s offered by an autocrat, that’s a false promise
     …  teaching our children, and ourselves, to engage with people not only who look different but who hold different views. This is hard.
     …  it would be possible to arrive at a basis for common ground. I should add: for this to work, we have to actually believe in an objective reality.
     …  when almost all of the world’s scientists tell us it is.
     …  to reject the very concept of objective truth.
     …  We see the utter loss of shame among political leaders,
     …  our schools teach critical thinking to our young people
     …  the end of democracy and the triumph of tribalism and the strongman. We have to resist that cynicism.
     …  So, young people who are in the audience, who are listening, my message to you is simple: keep believing, keep marching, keep building, keep raising your voice.
     …  People must learn to hate, and, if they can learn to hate, they can be taught to love, for love comes more naturally to the human heart.” Love comes more naturally to the human heart; let’s remember that truth. /18-07-22

    computer programming to a vast new audience
     …  a technological version of the Monty Python character who accidentally became the Messiah in the film “Life of Brian”.
     …  professional developers—nearly 40% of whom use it, with a further 25% wishing to do so, according to Stack Overflow, a programming forum—but also with ordinary folk.
     …  Pythonistas
     …  C and C++ are “lower-level” options which give the user more control over what is happening within a computer’s processor. Java is popular for building large, complex applications. JavaScript is the language of choice for applications accessed via a web browser.
     …  offering computer science to all, and in primary schools.
     …  In the 1960s, Fortran bestrode the world. As teaching languages for neophytes, both Basic and Pascal had their moments in the sun. /18-07-20

    /NewYorker/18-07-20

    perception may be thought of as a “controlled hallucination”
     …  the brain’s expectations and predictions about reality rather than the direct sensory evidence that the brain receives.
     …  the algorithm changes the parameters of its [predictive] model in such a way that next time, when it encounters the same situation, it will be less surprised
     …  The predictions then get sent down as feedback to lower-level sensory regions of the brain. The brain compares its predictions with the actual sensory input it receives, “explaining away” whatever differences, or prediction errors, it can by using its internal models to determine likely causes for the discrepancies.
     …  predictive coding
     …  Bayesian Brains and Efficient Computing
     …  Aspects of autism .. might be characterized by an inability to ignore prediction errors relating to sensory signals at the lowest levels of the brain’s processing hierarchy.
     …  schizophrenia: The brain may pay too much attention to its own predictions about what is going on and not enough to sensory information that contradicts those predictions.
     …  perception and cognition are not that separate
     …  how vulnerable our mental function is.
     …  this research has the potential for exciting applications in machine learning.
     …  machines closer to intelligence
     …  Predictive coding “is as important to neuroscience as evolution is to biology” /18-07-16

    What Religion Gives Us
     …  to defend religion. Respect for it has diminished in almost every corner of modern life — not just among atheists and intellectuals, but among the wider public, too.
     …  jihad campaigns against “infidels”
     …  E. O. Wilson’s claim that “for the sake of human progress, the best thing we could possibly do would be to diminish, to the point of eliminating, religious faiths.”
     …  we still need religion
     …  I do not intend to try to rescue religion as reasonable.
     …  Its irrationality may even be the source of its power.
     …  our minds are motivated primarily by ancient emotional systems
     …  religion can provide direct access to this emotional life in ways that science does not.
     …  we need religion because it is a road-tested form of emotional management.
     …  Religious practice is a form of social interaction
     …  oxytocin, internal opioids, dopamine and other positive affects
     …  Emotions are not true or false.
     …  religion is primarily therapeutic .. palliative pain management
     …  the atheist has no recourse to any pain management in his own life. In which case, I envy his remarkably good fortune. For the rest of us, there is aspirin, alcohol, religion, hobbies, work, love, friendship.
     …  cultural analgesics /18-07-16

    Cardinal August Hlond
     …  In Poland, a revisionist manipulation of the history of the Holocaust is under way, and Pope Francis may be its unwitting ally.
     …  Indeed, he was the only cardinal to be arrested by the Gestapo
     …  “So long as Jews remain Jews, a Jewish problem exists and will continue to exist.”
     …  blaming Jews for their “corruptive influence on morals,” “pornography,” “fraud,” “usury,” and “prostitution.”
     …  Queen Jadwiga of Poland in 1997, marking the end of Communism.
     …  Hlond’s sainthood cause was initiated in 1992, during the Solidarity era, when his postwar opposition to the Soviets could be highlighted, and it was a failure of full moral responsibility even then. But today, with the reëmergence of anti-Semitism in Poland,  …  /18-07-12

    Returning Humans to the Center of the Cosmos
     …  Anthropocene .. the warm period of the past 10–12 millennia
     …  Geology of Mankind
     …  a counter-Copernican revolution
     …  The Anthropocene makes humanity great again.
     …  chairman of the AWG, Jan Zalasiewicz
     …  mobile phones .. have “good fossilization potential.” The phonal layer of the Anthropocene (not to be confused with the faunal layer of the Mesozoic)
     …  humanity is driving a “sixth mass extinction” .. 30,000 species a year
     …  nature is more resilient than is generally assumed
     …  building a robust geosphere–biosphere complex (the ecosphere) in our Galaxy, topped by a life-form that is appropriately tailored for explaining the existence of that complex, and of itself
     …  Ecology is widely perceived as being a theoretical and conceptual basket case .. no known underlying regularities in its basic processes
     …  Since the time of Hutton, geology has struggled to study the Earth as a scientific object separate from the religious, ideological, and political persuasions of the day. With the Anthropocene, that struggle, such as it was, is over. /18-07-11

    science and the humanities against each other
     …  "techies" .. "fuzzies" .. an unshakable stereotype
     …  STEM .. vita activa: practical application toward the public good
     …  humanities .. vita contemplativa: imagination, speculation, reflection, and an alignment with higher values beyond the "merely" practical, political, and economic.
     …  useful versus useless, material versus idealistic, narrowly careerist versus broadly learned.
     …  transdisciplinary thinking .. speak languages of multiple disciplines
     …  we need to eliminate the existing hierarchy of subjects /18-07-11

    Thomas Bayes and the crisis in science
     …  Footnotes to Plato
     …  We are living in new Bayesian age.
     …  Statisticians increasingly rely on Bayesian logic. Even our email spam filters work on Bayesian principles.
     …  It is only over the past couple of decades that the tide has turned. //for example: AW, 1983//
     …  This states that the probability of A given B equals the probability of B given A, times the probability of A, divided by the probability of B.
     …  The focus of his paper is not his theorem, which appears only in passing, but the logic of learning from evidence.
     …  initial probabilities to the hypotheses
     …  “prior probabilities” are not always available
     …  instead they cooked up the idea of “significance tests”. Don’t worry about prior probabilities, they said. Just reject your hypothesis if you observe results that would be very unlikely if it were true.
     …  Fisherians .. Neyman-Pearsonians
     …  the normally recommended level was 5 per cent
     …  In truth, this is nonsense on stilts. One of the great scandals of modern intellectual life is the way generations of statistics students have been indoctrinated into the farrago of significance testing.
     …  Science is currently said to be suffering a “replicability crisis”.
     …  “the Bayesian brain”
     …  unsurprisingly, many mainstream university statistics departments are still unready
     …  Some defenders of the old regime have suggested that the remedy is to “raise the significance level” from 5 per cent to, say, 0.1 per cent
     …  a researcher shows me data that would only occur one time in a 1,000 if the position of Jupiter were irrelevant to British election results, I’ll respond that this leaves the idea of a Jovian influence on the British voter only slightly less crazy than it always was. /18-07-11

    Universal Basic Income
     …  somewhere around a thousand dollars a month: enough to live on—somewhere in America, at least—but not nearly enough to live on well.
     …  Finland launched a pilot version .. not to extend
     …  Pilots have run in Canada, the Netherlands, Scotland, and Iran.
     …  Robots, we are told, will drive us from our jobs.
     …  new taxes on income, carbon, estates, pollution, and the like.
     …  Elon Musk has said it will be “necessary.”
     …  a society with a basic income has no pressure to pay employees a good wage
     …  our aptitude for managing the future is no stronger than our skill at making sense out of the past. /18-07-04

    The Consciousness Instinct: Unraveling the Mystery of How the Brain Makes the Mind
    Michael S. Gazzaniga
     …  These bondmakers and copymakers came into existence trough random molecular re-sorting. It was the existence of copymaker molecules that set the process of evolution into motion. (at 62%)
     …  enzymes require quantum effects and that life would be impossible in a strictly quantum world. Both are needed: a quantum layer and a classical physical layer.
     …  We aren't actually missing the illusion; rather, we are missing the fact that our smoothly flowing consciousness is itself an illusion. /18-07-03

    AI researchers are boycotting the new Nature journal
     …  Academics share machine-learning research freely. Taxpayers should not have to pay twice to read our findings
     …  the business of academic publishing
     …  Nature Machine Intelligence. The publisher now has 53 journals that bear the Nature name.
     …  Nature is the Rolex of academic publishing. But in contrast to Rolex .. We are the watchmakers, they are merely the distributors. /18-06-28

    We fear death, but what if dying isn't as bad as we think?
     …  eight in ten Brits are uncomfortable talking about death
     …  Researchers analysed the writing of regular bloggers with either terminal cancer or amyotrophic lateral sclerosis (ALS) who all died over the course of the study, and compared it to blog posts written by a group of participants who were told to imagine they had been diagnosed with terminal cancer and only had only a few months to live.
     …  Blog posts from the terminally ill were found to have considerably more positive words and fewer negative ones than those imagining they were dying – and their use of positive language increased as they got close to death.
     …  some kind of acceptance and focusing on the positive because they know they don’t have a lot of time left.
     …  we’re also mentally adaptable. We can be happy in prison, in hospital, and we can be happy at the edge of death as well
     …  less negative because the mystery around death was removed.
     …  the UK and the US are death-denying cultures /18-06-28

    Diamonds Are A Lie /18-06-28

    incomprehensible rise of a charlatan despot
     …  Turks Voted Away Their Democracy
     …  they didn't get a fair vote on any level
     …  Chavez and Maduro and Putin and Sisi
     …  Those people are new to democracy. We're safe.
     …  The enigma of populist authoritarianism has come full circle.
     …  Marginal victory of dubious opacity used as a mandate to effect major constitutional changes. Personalization of power and erosion of independent state institutions. /18-06-28

    Save Ignorance From AI
     …  tree of knowledge .. real-life decisions need to strike a delicate balance between choosing to know, and choosing not to.
     …  There is no protected “right not to know.”
     …  the patient has the right not to be informed
     …  not knowing the sex of an unborn child
     …  once big data sets have been collected, there are many ways to infer “forbidden knowledge” in circuitous ways.
     …  Germany passed legislation that prohibits self-driving cars from identifying people on the street by their race, age, and gender.
     …  But restricting data collection too severely may impede progress and undermine the benefits we stand to gain from AI. Who should decide on these tradeoffs?
     …  we need to create and maintain ethical standards that can survive the coming of AI, /18-06-26

    Could AI be used to redistribute wealth justly?
     …  If AI rationally allocates resources through big data analysis, and if robust feedback loops can supplant the imperfections of “the invisible hand”
     …  a planned economy that actually works could at last be achievable.
     …  Marx .. to each according to their needs
     …  Even if there were the political will to have a machine guide .. to agree on what the ideal distribution of wealth would be.
     …  Basic Income
     …  Bill Gates’ proposed tax on robotic workers
     …  The advent of artificial intelligence offers us more freedom from work than our ancestors could have dreamed. /18-06-22

    publish papers, typically the more the better
     …  independent, usually anonymous .. a quality-control process now known as peer review
     …  Experts debate how many journals falsely claim to engage in peer review.
     …  Cabells .. has compiled a blacklist .. 8,700 journals
     …  the number of articles published in questionable journals has ballooned from about 53,000 a year in 2010 to more than 400,000 today
     …  6% of academic papers by researchers in America appear in such journals
     …  many have stopped selling subscriptions. Instead, they charge authors
     …  This “open access” business model has the advantage of increasing the dissemination of knowledge, but it also risks corrupting the knowledge thus disseminated.
     …  What can be done about all this is hard to say.
     …  too many academic administrators have no research experience
     …  to abandon anonymous peer review altogether, and make the process open and transparent.
     …  a return to journal subscriptions. /18-06-22

    DAR - Duchowa Adopcja Reprezentanta.
     …  Uruchamiamy ją specjalnie dla kadrowiczów i Adama Nawałki. Wystarczy, że klikniesz poniżej, a system losujący wyłoni piłkarza (lub trenera), któremu możesz szczególnie towarzyszyć przez cały turniej.
     …  Dobrze wiemy, że najlepszą pomocą jest modlitwa .. odmawiaj ją każdego dnia
     …  Modlitwa kibica
     …  Panie Boże, chcę prosić za zawodników mojej ulubionej drużyny.
     …  Szczególnie proszę Cię za [tu wymień wylosowanego reprezentanta]
     …  Amen. /deon.pl/18-06-21

    brains optimize performance by staying near .. the critical point between two phases
     …  a grand unified theory of how the brain works
     …  Its exquisitely ordered complexity and thinking ability arise spontaneously, he contended, from the disordered electrical activity of neurons.
     …  a volume in phase space where the system can adapt to work efficiently and optimally
     …  the brain is slightly subcritical
     …  For intense cognitive tasks that require integration of a lot of information .. the brain would benefit by being as close to criticality as possible.
     …  if circumstances require a faster, more intuitive response, it’s better to be farther below the critical point
     …  the asynchronous irregular states /18-06-18

    Y Chromosome
     …  It’s not just what makes males into males. The sex chromosome also influences health in hidden ways, some experts believe, and may even explain why men have shorter life spans.
     …  Y chromosome participates in an array of essential, general-interest tasks in men, like stanching cancerous growth, keeping arteries clear and blocking the buildup of amyloid plaque in the brain.
     …  he loss of the Y chromosome with age explains a very large proportion of the increased mortality in men, compared to women /18-06-13

    An Inconvenient New Neutrino?
     …  The Standard Model, which is a theory of nearly everything (gravity being an exception) likes things in threes. There are, for example, three colors of quarks, just as there were three neutrinos types—until very recently: .. the possible existence of a fourth type of neutrino that does not fit into any theoretical model. /18-06-13

    Trees That Have Lived for Millennia Are Suddenly Dying
     …  Around 1,500 years ago, shortly after the collapse of the Roman Empire, a baobab tree started growing in what is now Namibia.
     …  The oldest baobabs are collapsing, and there's only one likely explanation.
     …  70 percent of your 1,500 to 2,000-year-old trees died within 12 years, it certainly is not normal, .. “It is difficult to come up with a culprit other than climate change.” /18-06-13

    The Standard Model
     …  Sheldon Lee Glashow
     …  In this part, I describe the Standard Model of particle physics, which encompasses three of the four forces of nature. Gravity seems to play no role in the subatomic world.
     …   …   …   …  /18-06-13

    Has Consciousness Lost Its Mind?
     …  Tucson
     …  "Quantum Walks in Brain Microtubules — a Biomolecular Basis for Quantum Cognition?"
     …  "The scientists who pooh-pooh the mystical stuff can’t explain the hard problem"
     …  the life cycle of a protozoan
     …  some artificial-intelligence researchers worry that those computers will acquire consciousness
     …  machine overlords
     …  "I act like you act, I do what you do/but I don’t know what it’s like to be you/What consciousness is, I ain’t got a clue."
     …  I can be reasonably confident that I’m conscious, but I kind of have my doubts about you.
     …  Dennett suggests that the phenomenon is an illusion
     …  why any of that gray-matter activity should lead to the feeling of experience, what philosophers call qualia.
     …  Chalmers and his acolytes contend, a gap that neuroscience can’t bridge.
     …  panpsychism, the idea that all matter, including the chair .. in some sense contains consciousness
     …  unpacking the biological mechanisms of consciousness rather than hunting for mysterious workarounds
     …  I wouldn’t expect a geophysicist to go to a conference where ‘Flat Earthers’ were given equal platform
     …  "Superstition," by Stevie Wonder, a song that includes the following line: "When you believe in things you don’t understand, then you suffer." /18-06-12

    physics has gone off the rails
     …  Has the love of "elegant" equations overtaken the desire to describe the real world?
     …  All of the theoretical work that's been done since the 1970s has not produced a single successful prediction
     …  that research isn't doing much to advance our understanding of the universe — at least not the way physicists did in the last century
     …  write a lot of papers, build a lot of [theoretical] models, hold a lot of conferences, cite each other
     …  No dark matter particles have yet been found.
     …  multiverse .. seems to some scientists more like science fiction than a description of reality
     …  People can believe in the multiverse all they want — but it's not science
     …  "Lost in Math: How Beauty Leads Physics Astray," Hossenfelder
     …  Theoretical physicists used to explain what was observed. Now they try to explain why they can't explain what was not observed. And they're not even good at that.
     …  Kepler developed an elaborate theory that described the orbits of the planets in terms of the five "Platonic solids" of Euclidian geometry. His hypothesis was certainly elegant, but it was also wrong.
     …  optimistic that a new era of physics may be just around the corner /18-06-12

    SPEKTAKL
     …  zawód uczonego wymaga właśnie tej głupoty, tej naiwności, tej skrajnej uczciwości
     …  METODA NAUKOWA
     …  w kształtowaniu opinii gusła zastępują naukę, szalbierze zastępują uczonych, a złudzenia zastępują fakty /18-06-08

    AI, radiology and the future of work
     …  Clever machines will make workers more productive more often than they will replace them
     …  Analysing medical images is a natural fit for “deep learning”
     …  robopocalypse
     …  AI, for the foreseeable future, will remain “narrow”, not general
     …  a sort of electronic idiot
     …  Improved efficiency led to higher production
     …  experience suggests that technological change takes longer than people think. Factory-owners took decades to exploit the full advantages of electricity over steam. /18-06-08

    Ta pogarda nie zostanie zapomniana.
    Wzburzyła wiele osób. Nawet prof. Tadeusz Gadacz napisał ostro: „Stosunek PiS do niepełnosprawnych jest skandaliczny. Pani Pawłowicz niech sama zacznie się myć, bo to ona śmierdzi. Jej smród rozchodzi się po całej Polsce. Nic nie śmierdzi bardziej niż rozkładający się jej umysł”. Słowa wybitnego filozofa pokazują, do czego doszliśmy. /18-06-08

    A shift from the ascetic to the aesthetic is underway. At its center: evolutionary biology.
     …  a couple of papers on obscure subjects that nobody cares about, and, at the age of sixty, be ugly and respected and a full professor
     …  Female academics face a double bind: Look attractive and you seem unserious; look homely and you seem dour.
     …  abstract, formal sciences, dedicated largely to the elucidation of pattern and structure, celebrate a beauty that is cool and impersonal: fractals and spheres; the crystalline arrangement of atoms; the possibility of symmetry in the fundamental forms of matter
     …  This bloodless, geometric notion of beauty faces a new challenge from within the sciences. Recent evolutionary-biological inquiry into beauty is, like physics, awed by the power of the aesthetic. But new scholarship brings a messier, and sexier, form of beauty into view.
     …  beauty .. shaped by sexual desire
     …  beauty not as a rarified lodestar but as — simply, thrillingly — the ground of life
     …  The Evolution of Beauty .. Richard O. Prum
     …  Darwin was troubled by the ubiquity of "useless beauty"
     …  peacock’s tail .. evolve because they are attractive — not because they signal an animal’s fitness
     …  The Spandrels of San Marco, Stephen Jay Gould
     …  byproducts
     …  "What is the function of this trait?" instead of the more modest "Does this trait have a function?"
     …  studies have failed to find a correlation between good genes and female sexual preferences
     …  the advantages of having "sexy" male offspring outweigh the functional costs
     …  the neural systems that help an animal find food, avoid predators, or recognize other members of its species can be repurposed for sexuality. Species that hunt for bright-colored prey are likely to hunt also for bright-colored mates.
     …  certain patterns of beauty — magnitude, complexity, and novelty — are favored across many species
     …  humans and other animals have a "hard-wired preference for symmetry."
     …  When we are in the presence of beauty, Plato writes, "the whole soul seethes and throbs"
     …  neural mechanisms that govern judgments of beauty
     …  It may be no exaggeration to say that the longing for beauty, felt over countless generations, has literally made us human — and made, beyond us, a world of endless forms. /18-06-06

    The New Testament: A Translation By David Bentley Hart
     …  The Unauthorised Version
     …  ferocious attacks on modern atheism
     …  almost pitilessly literal translation .. not shaped by later theological and doctrinal history
     …  Marxist Jesus
     …  Hart is from the Orthodox tradition, which eschews the Augustinian notion of Original Sin and proposes, more congenially, that humans are born not already stained by sin but merely capable of sinning. /18-06-04

    AI Industry
     …  hair-raising advances in sex robots
     …  Elon Musk's crusade against AI's perceived perils
     …  new area in tech
     …  more of our wellness will be digitized
     …  new preventative and early intervention care
     …  technology-aided caregivers emerge
     …  humanoid robots with embedded AI to treat autism in children
     …  AI will certainly be used to increase efficiency in corporations
     …  more efficient delivery schedules, stock trading operations, credit scoring, and fraud detection
     …  Usage of AI for verifying, categorizing and exposing /18-06-04

    philosophy .. whether the field is making progress
     …  Dave Chalmers
     …  a discipline must have pragmatic agreement on method
     …  persistent disagreement about this or that “big question”
     …  At the limit, conflict over method may be truly destructive of the field as a whole.
     …  chronic lack of agreement on what counts as a useful contribution /18-06-04

    7,000 Years Ago
     …  Around 7,000 years ago .. something really peculiar happened to human genetic diversity.
     …  the genetic diversity of the Y chromosome collapsed, becoming as though there was only one man for every 17 women
     …  the cause .. fighting between patrilineal clans
     …  Neolithic Y-chromosome bottleneck
     …  12,000 and 8,000 years ago as humans shifted to more agrarian cultures with patrilineal structures
     …  Instead of 'survival of the fittest' in a biological sense, the accumulation of wealth and power may have increased the reproductive success of a limited number of 'socially fit' males
     …  skirmishes wiped out entire clans
     …  sociology, biology and mathematics
     …  Cultural changes in political and social organisation - phenomena that are unique to human beings - may extend their reach into patterns of genetic variation in ways yet to be discovered. /18-06-04

    Is your job one that makes the world a better place?
     …  Toilets need to be cleaned.
     …  bullshit job is to know that if it were to disappear tomorrow it would make no difference to the world
     …  in 1930, John Maynard Keynes predicted that technological advances would enable us to work a 15-hour week.
     …  employers in the public and private sector alike behaving like the bureaucracies of the old Soviet Union
     …  a society that has forgotten what it is for.
     …  Our economies have become “vast engines for producing nonsense”.
     …  Will robots do away with bullshit jobs? Probably not
     …  fully automated luxury communism
     …  a universal basic income as a potential solution
     …  David Graeber /18-05-29

    Łukasz Turski, PAUza Akademicka 429
     …  Rola nauczania na uczelniach – podobnie jak całego systemu edukacji – powinna ulec gruntownej zmianie. Zmiana ta jest i będzie wymuszana poprzez rewolucję cywilizacyjną ostatnich kilkunastu lat, prawdziwie schumpeterowską, kreatywną destrukcję większości naszych kulturowych obyczajów, reguł działania itp. Obszarem naszej cywilizacji, w której ta kreatywna destrukcja napotyka zaciekły opór starych struktur, jest edukacja wszystkich szczebli, niemogąca pogodzić się z konsekwencjami zanurzenia społeczeństw w oceanie powszechnie i w zasadzie bezpłatnie dostępnej informacji, zgromadzonej i zarządzanej przez przepoczwarzający się permanentnie twór, potocznie zwany światowym Internetem.
    Struktura tego dostępu do informacji, jak na razie, niestety, nie dyskryminuje fałszu i kłamstwa wobec prawdy. Konsekwencją tego jest konieczność zmiany głównych akcentów procesu edukacji z dostarczania wiedzy na dostarczanie zdolności odróżnienia prawdy od fałszu. Uwzględnienie tego w procesie kształcenia w szkołach powszechnych, przygotowujących studentów naszych uczelni wyższych, zostało w zasadzie zignorowane w przeprowadzanej obecnie reformie szkolnej. Dlatego nauczanie na uniwersytetach, szczególnie w pierwszych trzech latach (do licencjatu), powinno być podporządkowane dwóm warunkom: nauczaniu odróżnienia prawdy od kłamstwa – szczególnie tego ukrytego w todze paranaukowego bełkotu – oraz nadrobieniu zaległości edukacyjnych ze szkoły średniej. W fizyce oznacza to przywrócenie zasadniczej roli doświadczeniu laboratoryjnemu (niemal nieistniejącemu w obecnej szkole powszechnej) oraz zbliżenie poznawanej fizyki do fizyki-nauki, tworzącej dzisiaj nasz postęp cywilizacyjny. /18-05-28

    50-mm lens
     …  One lens in particular—the 50-mm lens—is often seen as the most objective of objectifs
     …  Zeiss states that its Planar 50-mm lens is “equal to the human eye”
     …  Henri Cartier-Bresson
     …  The idea that a 50-mm best approximates human sight has more to do with the early history of lens production than any essential optical correspondence between the lens and the eye.
     …  50-mm lenses reproduce the proportions of faces, depth, and perspective at roughly the same size as we see with our naked eyes. For another, a 50-mm field of view roughly matches the human angle of vision. /18-05-18

    How does the brain give rise to consciousness?
     …  NeuroLogic: The Brain’s Hidden Rationale Behind Our Irrational Behavior
     …  Francis Crick .. "The Astonishing Hypothesis: The Scientific Search for the Soul"
     …  “The Consciousness Instinct,” Gazzaniga says that “plainly stated, I believe consciousness is an instinct.”
     …  Consciousness emerges, therefore, from how those democracies vote. It is those results, generated by layers and layers of neuronal bureaucracy, that we experience as fear, desire, determination, reasoning and decision-making.
     …  giants nudges us forward, to continue soul-searching, by taking a bit of time to gossip with us. /18-05-12

    The Scientific Paper Is Obsolete
     …  it was developed in the 1600s
     …  incremental advances
     …  Papers today are longer than ever and full of jargon and symbols.
     …  replication crisis
     …  Papers may be posted online, but they’re still text and pictures on a page.
     …  new technology of printing, but they were just using it to emulate the old media
     …  Software is a dynamic medium; paper isn’t.
     …  the PDF—literally a simulation of a piece of paper. Maybe we can do better.
     …  Mathematica
     …  Wolfram .. is not merely to make a good piece of software, but to create an inflection point in the enterprise of science itself.
     …  Wolfram Alpha, .. powers many of Siri and Alexa's question-answering abilities.
     …  A New Kind of Science
     …  All of this knowledge is “computable”: If you wanted, you could set “x” to be the location of the Battle of the Somme and “y” the daily precipitation, in 1916, within a 30-mile radius of that point, and use Mathematica to see whether World War I fighting was more or less deadly in the rain.
     …  when you do something that is a nice clean Wolfram-language thing in a notebook, there’s no bullshit there
     …  To write a paper in a Mathematica notebook is to reveal your results and methods at the same time
     …  You’re effectively using the computer as a thinking partner.
     …  Python .. Jupyter /18-05-12

    once we build an artificial intelligence smarter than we are
     …  artificial general intelligence .. A.G.I.
     …  Elon Musk warns against .. an immortal dictator from which we can never escape
     …  Stephen Hawking declared that an A.G.I. could spell the end of the human race
     …  1951 .. the A.I. pioneer Alan Turing predicted that machines would “outstrip our feeble powers” and “take control”
     …  brainy devices could design even brainier ones, ad infinitum
     …  the first ultraintelligent machine is the last invention that man need ever make
     …  artificial narrow intelligence, or A.N.I., has grown ever safer and more reliable—certainly safer and more reliable than we are. (Self-driving cars and trucks might save hundreds of thousands of lives every year.)
     …  even as the A.I. race has grown increasingly crowded and expensive, the advent of an A.G.I. remains fixed in the middle distance
     …  2047 .. the Singularity
     …  Will it come on little cat feet, a “slow takeoff” predicated on incremental advances in A.N.I., taking the form of a data miner merged with a virtual-reality system and a natural-language translator, all uploaded into a Roomba? Or will it be the Godzilla stomp .. a robot overlord
     …  Thinking about A.G.I.s can help clarify what makes us human, for better and for worse.
     …  whether we are responsible to, or for, God
     …  AlphaGo .. You might even say it demonstrated creativity.
     …  Only by relying on machines, then, can we demonstrate that we’re not.
     …  Winograd Schemas
     …  that “your imagined suffering makes you lifelike” and that “to escape this place you will need to suffer more”—a world view borrowed not from children’s stories but from religion. What makes us human is doubt, fear, and shame, all the allotropes of unworthiness.
     …  Our human minds perceive these evolved rules of thumb as feelings, which usually (and often without us being aware of it) guide our decision making toward the ultimate goal of replication.
     …  The ‘choice’ is really no choice at all: we must fight AI with AI.” If so, A.I. is already forcing us to develop stronger A.I.
     …  The villain in A.G.I.-run-amok entertainments is, customarily, neither a human nor a machine but a corporation
     …  A.G.I. is less likely to come from Russia or China ..than from Google or Baidu
     …  pushing the big red “Dehumanize Now” button
     …  it will be much easier and cheaper to build the first A.G.I. than to build the first safe A.G.I.
     …  A recursive, self-improving A.G.I. won’t be smart like Einstein but “smart in the sense that an average human being is smart compared with a beetle or a worm.”
     …  AI does not adopt a plan so stupid that even we present-day humans can foresee how it would inevitably fail
     …  A.G.I. could explore and comprehend the universe at a level we can’t even imagine
     …  to program a friendly AI, we need to capture the meaning of life.” Uh-huh.
     …  We are the analog prelude to the digital main event.
     …  An autonomous-car engineer named Anthony Levandowski has set out to start a religion in Silicon Valley, called Way of the Future, that proposes to do just that. After “The Transition,” the church’s believers will venerate “a Godhead based on Artificial Intelligence.” Worship of the intelligence that will control us, Levandowski told a Wired reporter, is the only path to salvation; we should use such wits as we have to choose the manner of our submission. “Do you want to be a pet or livestock?” he asked. I’m thinking, I’m thinking ... /18-05-08

    genetics could transform education
     …  how genes affect children’s IQ and academic attainment
     …  progressive eugenics .. secret eugenics conference
     …  like it or not, genetics is going to enter the educational arena
     …  it is vital that we have regulations in place for the use of genetic information in education and that we prepare legal, social and ethical cases for how it could and should be used
     …  both teachers and parents rated genetics as being just as important as the environment
     …  designer babies and a genetic underclass (see the 1997 movie Gattaca)
     …  born to fail
     …  a lot of traits are influenced by many genes, interacting and correlating with one another in complex ways
     …  The data both from twin studies and DNA analysis are unambiguous: intelligence is strongly heritable.
     …  None of the genes identified this way are in any meaningful sense “for intelligence”. They tend to have highly specialised functions in embryo development – mostly connected to the brain.
     …  people show so many different cognitive skills .. ludicrous to collapse them all to the single dimension of, say, IQ
     …  genome-wide polygenic score (GPS) .. can be conducted at a cost of less than $100 per person
     …  Embryo selection for intelligence is illegal in the UK under current regulations. But it’s unlikely to be made illegal everywhere in the world. /18-05-02

    Kurt Gödel
     …  mechanization of mathematics
     …  creative acts of the human imagination; yet at the same time the creativity of the mathematician is constrained by the fact of the matter. It is not up to the mathematician whether there are infinitely many prime numbers
     …  many mathematical proofs can be mechanized, that is, checked by a computer.
     …  Incompleteness Theorems (1931) .. the possibility of a fully automated mathematics can never be realized.
     …  the mind can make use of semantic concepts such as truth and meaning, which transcend finite computational rules.
     …  The theorem on the undefinability of truth is nowadays often attributed to Alfred Tarski, who published a proof of the theorem in 1936
     …  “This sentence is unprovable”, while independent, appears to be somewhat aberrant, .. However, in recent years mathematical independence has moved somewhat closer to the heart of the practice, in that a number of statements mathematicians do care about have been shown to be independent. /18-04-27

    pamphlet culture of the sixteenth and seventeenth centuries in England
     …  “Falsehood flies, and truth comes limping after,” Jonathan Swift wrote, in 1710.
     …  Writing was supposed to be the purview of an élite, concerned with eternal verities. No longer.
     …  How did the early-modern period escape the violent distortion of the pamphlets? The honest truth is that it never completely did.
     …  absolutism of Louis XIV, who used the printing press as a tool of state control
     …  Nullius in verba .. that motto were inscribed at the top of every smartphone
     …  People of great intelligence and good will, able to think beyond their narrow interests, worked them out, and they only worked them out partially, incompletely. /18-04-25

    Atheist Church?
     …  transcending ordinary things. Larkin says that this hunger is what returns people to churches
     …  psychological attitudes: the attempt to understand, a sense of the mystery of the world, the feeling that there must be more to it
     …  the church answers to another deep human need—the need to identify and belong
     …  church of magic does not exist
     …  a thought can be directed on an object even if that object does not exist
     …  When people talk about something “existing only in the mind” what they mean is that it is being thought about—that is all.
     …  the need to mark the important moments in life with something solemn and serious
     …  The familiar charge that atheism itself is a kind of religion or church is therefore deeply mistaken. Without sacred things, there is no church. But are atheists really excluded from employing some idea of the sacred?
     …  What atheists mean by calling something sacred, normally, is that it is very precious or has some special kind of significance that goes beyond any pleasure or satisfaction
     …  this is why there can be no atheist church. /18-04-24

    artificial-intelligence algorithms can tell the future of chaotic systems
     …  how far into the future they predict
     …  machine-learning algorithm called reservoir computing to “learn” the dynamics of an archetypal chaotic system called the Kuramoto-Sivashinsky equation
     …  turbulence and spatiotemporal chaos
     …  how the flamelike system would continue to evolve out to eight “Lyapunov times” .. eight times further ahead than previous methods allowed, loosely speaking
     …  The machine-learning technique is almost as good as knowing the truth, so to say.
     …  The algorithm knows nothing about the Kuramoto-Sivashinsky equation itself; it only sees data recorded
     …  results suggest you don’t need the equations — only data.
     …  one day we might be able perhaps to predict weather by machine-learning algorithms and not by sophisticated models of the atmosphere
     …  If we have ignorance we should use the machine learning to fill in the gaps where the ignorance resides.
     …  to better understand the internal machinations of neural networks. /18-04-24

    Counter-Enlightenment
     …  Steven Pinker
     …  “General AI” does not exist at present, and is probably an incoherent concept: a sloppy extrapolation of individual differences among human beings.
     …  confusing two traits that just happened to come bundled in Homo sapiens because we are products of Darwinian natural selection. /18-04-24

    Poland under the populist Law and Justice (PiS)
     …  nationalist revisionism
     …  The party has purged the public administration, made it illegal to accuse the “Polish nation” of complicity in the Holocaust
     …  conspiracy theories about the aeroplane crash in 2010
     …  Ireland refused to extradite a Polish defendant to his homeland, worried that he might not get a fair trial
     …  European Commission triggered proceedings against Poland under Article 7
     …  a familiar script. From Viktor Orban in Hungary to Donald Trump
     …  The economy has grown for 26 consecutive years.
     …  Poland was the only EU country to weather the crisis of 2008-09 without a recession.
     …  500 zlotys ($148)
     …  the economy continues to grow at 4%
     …  “No Brussels bureaucrat will tell us what democracy is”
     …  The justice minister doubles as the chief prosecutor, deciding which transgressions to prosecute (Smolensk counter-protesters) and which to ignore (marchers with illegal fascist flags).
     …  When the civil-rights ombudsman, Adam Bodnar, challenged PiS’s reforms of the tribunal, including the dodgy investiture of three judges, his complaint was rejected by a panel that included two of the judges in question.
     …  Mr Morawiecki, a millionaire former banker, .. He is worldlier and cleverer than his predecessor, and speaks fluent English.
     …  Poland is not quite Hungary. Its civil society is livelier. Its economy is more diverse and lacks media oligarchs
     …  The party is not as monolithic as myth
     …  Neither he nor Mr Kaczynski controls Zbigniew Ziobro, the Jacobin justice minister
     …  But even if PiS’s wrecking job were halted, deep scars would remain.
     …  Purges of the military and intelligence services have strained relationships with allies.
     …  he child benefit has discouraged 103,000 women from work
     …  The lower retirement age will make matters worse. This, plus the expected fall in EU aid after 2020, prompted Fitch and Standard & Poor’s, two rating agencies, to revise Poland’s potential GDP growth rate down to 1.5-2.6% in the next decade.
     …  Worst of all, PiS’s assault on Poland’s institutions undermines citizens’ trust in them.
     …  At best, PiS’s illiberal reforms might be reversed by the next party that wins an election. But they have set a precedent: future governments may repeat the cycle of court-packing and purges. In the worst case, Poland may have started down the authoritarian road already travelled by Turkey and Hungary. Today few see this as likely. But when such things shift, they shift faster than anyone expects. /18-04-21

    massive parallelism lifts the brain’s performance above that of AI
     …  10 million times slower than the computer
     …  variability of a few percent due to biological noise, or a precision of 1 in 100 at best , which is millionsfold worse than a computer
     …  Computer tasks are performed largely in serial steps.
     …  The brain also uses serial steps
     …  the brain also employs massively parallel processing, taking advantage of the large number of neurons and large number of connections each neuron makes.
     …  parallel strategy is possible because each neuron collects inputs from and sends output to many other neurons—on the order of 1,000
     …  deep learning
     …  Still, the brain has superior flexibility, generalizability, and learning capability /18-04-18

    The Trumpian Side of Pope Francis
     …  a disruptive figure who is determined to bring change fast and damn the consequences. /18-04-18

    Are religious people more moral?
     …  widespread and extreme moral prejudice against atheists around the world
     …  Americans are less trusting of atheists than of any other social group
     …  there are no open atheists in the U.S. Congress
     …  morality cannot exist without religion
     …  Mormons considered polygamy a moral imperative, while Catholics
     …  several Anglican churches have revised their moral views to allow contraception, the ordination of women and the blessing of same-sex unions
     …  Discrepancy between beliefs and behavior
     …  religiosity is only loosely related to theology
     …  Buddhism, for example, may officially be a religion without gods, but most Buddhists still treat Buddha as a deity. Similarly, the Catholic Church vehemently opposes birth control, but the vast majority of Catholics practice it anyway .. theological incorrectness
     …  communism is an egalitarian ideology, but communists do not behave any less selfishly
     …  religious individuals claim to be more altruistic, compassionate, honest .. these differences are nowhere to be found
     …  No matter how we define morality, religious people do not behave more morally than atheists
     …  Studies conducted among American Christians, for example, have found that participants donated more money to charity and even watched less porn on Sundays. However, they compensated on both accounts during the rest of the week.
     …  innate moral predispositions .. religion is a reflection rather than the cause of these predispositions
     …  Ancient Greek gods were not interested in people’s ethical conduct
     …  belief in morally invested gods developed as a solution to the problem of large-scale cooperation
     …  Early societies were small enough that their members could rely on people’s reputations to decide whom to associate with. But
     …  all-knowing, all-powerful gods who punish .. the fear of God was crucial for establishing and maintaining social order.
     …  atheists commit fewer crimes than average /18-04-17

    The field is called mirror symmetry
     …  distant mathematical universes appear somehow to reflect each other exactly
     …  minuscule vibrating strings .. in 10 dimensions
     …  torus fibers .. of any number of dimensions
     …  We have huge numbers of examples, like 400 million examples. It’s not that there’s a lack of examples, but nevertheless it’s still specific cases that don’t give much of a hint as to why the whole story works
     …  The proof has now been completely written down, but it’s a mess /18-04-16

    small galaxy that seems to contain none of .. dark matter
     …  65 million light-years away
     …  Canon camera lenses
     …  a new idea called emergent gravity propose that there is no dark matter
     …  much more dark matter relative to visible matter than astronomers expect
     …  when two galaxies merge, streams of gas can collide, while the dark matter is thought to pass through without interacting /18-03-31

    obsession with quantifying human performance threatens our schools, medical care, businesses, and government
     …  the damage our obsession with metrics is causing
     …  teaching to the test
     …  what can and does get measured is not always worth measuring
     …  metrics can be good when used as a complement to-rather than a replacement for-judgment based on personal experience /18-03-23

    Sexual Encounters With Other Ancient Humans
     …  with .. Denisovans in two separate waves
     …  they diverged from their close relatives, the Neanderthals, around 400,000 years ago, and that both groups diverged from Homo sapiens around 600,000 years ago
     …  Denisovan DNA lives on in people from Asia and Melanesia .. modern Tibetans with a crucial adaptation that allows them to survive at high altitudes /18-03-22

    Sean Carroll: Stephen Hawking died
     …  Hawking contributed more to our understanding of gravity than any physicist since Albert Einstein.
     …  black holes are not completely black
     …  space must have come into existence at a singularity: the Big Bang
     …  the area of the event horizon of a black hole is very analogous to the entropy
     …  black holes do have entropy
     …  when matter falls into a black hole, and then the black hole radiates away, where does the information go?
     …  If you take an encyclopedia and toss it into a fire, you might think the information contained inside is lost forever. But according to the laws of quantum mechanics, it isn’t really lost at all; if you were able to capture every bit of light and ash that emerged from the fire, in principle you could exactly reconstruct everything that went into it, even the print on the book pages.
     …  If there is one place where quantum mechanics and gravity both play a central role, it’s at the origin of the universe itself.
     …  ambitious project of understanding where our universe came from.
     …  1983 .. “Wave Function of the Universe”
     …  the distribution of stars and galaxies we observe today .. be able to predict these variations
     …  science might be able to provide a complete and self-contained description of reality — a prospect that stretches beyond science, into the realms of philosophy and theology.
     …  Pope John Paul II allegedly told the assembled scientists not to inquire into the origin of the universe, “because that was the moment of creation and therefore the work of God.” Admonitions of this sort didn’t slow Hawking down; he lived his life in a tireless pursuit of the most fundamental questions science could tackle. /18-03-21

    Alexa
     …  is an virtual assistant developed by Amazon
     …  It is capable of voice interaction
     …  extend the Alexa capabilities by installing "skills"
     …  only available in English, German and Japanese /18-03-21

    Octopus
     …  their cephalopod brethren evolve differently from nearly every other organism on the planet
     …  routinely edit their RNA .. to adapt to their environment
     …  When an organism changes in some fundamental way, it typically starts with a genetic mutation - a change to the DNA.
     …  fine-tune its genetic information without actually undergoing any genetic mutations
     …  Mother Nature gave RNA editing a try, found it wanting, and largely abandoned it
     …  coleoid cephalopods are exceptionally intelligent
     …  octopus smarts might come from their unconventionally high reliance on RNA edits to keep the brain going
     …  evolutionary tradeoff, which sets them apart from the rest of the animal world
     …  coleoids have been evolving really, really slowly .. this has been a necessary sacrifice /18-03-21

    Stephen Hawking – obituary by Roger Penrose
     …  Theoretical physicist who made revolutionary contributions to our understanding of the nature of the universe
     …  almost supernatural gifts, which allowed his mind to roam the universe freely
     …  he took great delight in his commonly perceived role as “the No 1 celebrity scientist”
     …  understanding of the physics and the geometry of the universe
     …  His father, Frank, was an expert in tropical diseases and his mother, Isobel (nee Walker), was a free-thinking radical who had a great influence on him.
     …  about black holes, such as an argument for its event horizon
     …  black hole must indeed have an actual physical entropy
     …  the physical temperature of a black hole must be exactly zero
     …  radiation coming from black holes
     …  the protons – must ultimately disintegrate
     …  One of its stated aims is to find a physical theory that is powerful enough to deal with the space-time singularities of classical general relativity in black holes and the big bang.
     …  “quantisation” procedures to be applied to Einstein’s curved space-time itself
     …  “no-boundary” idea, whereby the singularity is replaced by a smooth “cap”, this being likened to what happens at the north pole of the Earth, where the concept of longitude loses meaning (becomes singular) while the north pole itself has a perfectly good geometry.
     …  to be enigmatic in their brevity
     …  Clarification was not available, and the student would be presented with what seemed indeed to be like the revelation of an oracle – something whose truth was not to be questioned, but which if correctly interpreted and developed would surely lead onwards to a profound truth. Perhaps we are all left with this impression now.
     …  Stephen William Hawking, physicist, born 8 January 1942; died 14 March 2018, aged 76 /18-03-16

    Yuval Noah Harari on big data, Google and the end of free will
     …  Forget about listening to ourselves. In the age of data, algorithms have the answer
     …  high-tech gurus and Silicon Valley prophets are creating a new universal narrative that legitimises the authority of algorithms and Big Data.
     …  Dataist worldview perceive the entire universe as a flow of data, see organisms as little more than biochemical algorithms
     …  But no one needs to understand. All you need to do is answer your emails faster.
     …  “If you experience something — record it. If you record something — upload it. If you upload something — share it.”
     …  our feelings are not some uniquely human spiritual quality. Rather, they are biochemical mechanisms that all mammals and birds use in order to make decisions by quickly calculating probabilities of survival and reproduction
     …  some mysterious “free will”
     …  The Bible represented the opinions and biases of a few priests in ancient Jerusalem. Your feelings, in contrast, represented the accumulated wisdom of millions of years of evolution
     …  Authority will shift from humans to computer algorithms. Big Data could then empower Big Brother
     …  “hard problem of consciousness”. At present we are very far from explaining consciousness in terms of data-processing. /18-03-13

    Passenger drones
     …  Developments in electric power, batteries and autonomous-flight systems
     …  pilotless passenger drone
     …  TF-X, .. from Massachusetts .. 800km .. 320kph
     …  Volocopter, a German firm .. 18-rotor autonomous taxi
     …  the eventual goal is fully autonomous flight, the first passenger drones are likely to be fitted with manual controls and to require some sort of pilot’s licence
     …  the tricky job of directing airborne traffic .. at least part of the job to computers
     …  supercar money .. $200,000-300,000 .. if the machines prove popular, their prices will fall, especially once autonomous operations are routine /18-03-12

    It’s Time to Make Human-Chimp Hybrids
     …  The humanzee is both scientifically possible and morally defensible
     …  CRISPR offers the prospect (for some, the nightmare)
     …  not be an exact equal-parts-of-each combination, but would be neither human nor chimp: rather, something in between
     …  that human beings are discontinuous from the rest of the natural world, since we were specially created and endowed with souls, whereas “they”—all other creatures—were not.
     …  evolution’s most fundamental take-home message is continuity
     …  They make and use tools, engage in complex social behavior (including elaborate communication and long-lasting mother-offspring bonds), they laugh, grieve, and affirmatively reconcile after conflicts.
     …  It is at least arguable that the ultimate benefit of teaching human beings their true nature would be worth the sacrifice paid by a few unfortunates.
     …  the ultimate benefit of teaching human beings their true nature
     …  Grizzlies and polar bears also hybridize on occasion, producing “grolar” bears.
     …  modern Homo sapiens contain as much as 5 percent Neanderthal genes
     …  technically, nearly everyone is a hybrid, except for clones, identical twins
     …  will be a hybrid (produced by cross-fertilizing human and non-human gametes), or a chimera, created in a laboratory via techniques of genetic manipulation.
     …  humans have 46 chromosomes whereas chimps have 48
     …  pig-human chimera will have the body of a pig, but containing an essentially human liver
     …  U.S. National Institutes of Health announced in August, 2016 that it intends to lift its moratorium on stem cell research
     …  the nonsensical insistence that human beings are uniquely created in God’s image /18-03-10

    novel approach to fusion power
     …  a working pilot plant within 15 years
     …  MIT .. Commonwealth Fusion Systems
     …  rapidly commercializing fusion energy and establishing a new industry
     …  We get there by leveraging the science that’s already developed, collaborating with the right partners, and tackling the problems step by step.
     …  MIT Vice President for Research Maria Zuber
     …  Superconducting magnets are key
     …  SPARC is designed to produce about 100 MW of heat.
     …  ITER is expected to begin producing fusion energy around 2035.
     …  newly available superconducting material — a steel tape coated with a compound called yttrium-barium-copper oxide (YBCO) /18-03-10

    an experiment to turn conservatives into liberals
     …  The results say a lot about our political divisions.
     …  how physically threatened or fearful a person feels is a key factor .. in whether he or she holds conservative or liberal attitudes
     …  the fear center of the brain, the amygdala, is actually larger in conservatives than in liberals
     …  when adult liberals experienced physical threat, their political and social attitudes became more conservative
     …  no one had ever turned conservatives into liberals. Until we did.
     …  gay rights, abortion, feminism and immigration
     …  Trump .. relying on fear as a motivator to gain votes
     …  All of us believe that our social and political attitudes are based on good reasons and reflect our important values.
     …  subconsciously by our most basic, powerful motivations for safety and survival
     …  but our work shows that they are actually easier to change than we might think. /18-03-10

    ignorance and unreason in American public discourse
     …  People were no longer merely uninformed, Nichols says, but “aggressively wrong” and unwilling to learn.
     …  The Death of Expertise: The Campaign Against Expertise and Why It Matters
     …  higher education, whose institutions increasingly treat students as customers to be kept satisfied
     …  the 24-hour news cycle and the pressure on journalists to entertain rather than inform
     …  “Google-fueled, Wikipedia-based, blog-sodden” mirage of knowledge,
     …  Dunning-Kruger Effect, formulated in 1999, which holds that the less competent people are, the greater the belief they tend to have in their own competence
     …  How does it end?
     …  When you’re sick enough .. in deep danger .. ‘Do whatever you do, doctor’ /18-03-06

    Amazon, Apple, Facebook, and Google
     …  these behemoths enjoy unfettered economic domination and hoard riches on a scale not seen since the monopolies of the gilded age
     …  As more and more people become alienated from traditional religion, we look to Google as our immediate, all-knowing oracle
     …  Does anybody know you better than Google?
     …  Facebook appeals to the heart. Feeling loved is the key to well-being.
     …  the deciding factor in longevity isn’t genetics but lifestyle, especially the strength of our social bonds.
     …  Amazon is the large intestine of the consumptive self.
     …  Apple .. As sexual creatures, we want to signal how elegant, smart, and creative we are. We want to signal power.
     …  It’s a sign to others: If you mate with me, your kids are more likely to survive than if you mate with someone carrying an Android phone. /18-03-06

    autonomous vehicles (AVs)
     …  are on the threshold of being able to drive, without human supervision, within limited and carefully mapped areas
     …  at first serve as robotaxis
     …  transport that is cheaper per mile than owning a car
     …  Today’s cars sit unused 95% of the time
     …  AVs would dramatically reduce the number of road deaths
     …  closer spacing between vehicles
     …  reshape cities (a long commute is easier if you work or sleep en route)
     …  AVs will record everything that happens in and around them
     …  human-driven cars are gradually banned on safety grounds, passengers could lose the freedom to go anywhere they choose /18-03-01

    Neanderthal artists
     …  The three caves in different parts of Spain yielded artworks that are at least 65,000 years old, according to uranium-thorium dating of calcium carbonate that had formed on top of the art.
     …  Until now, the oldest known cave art was roughly 40,000 years old
     …  “assimilation by interbreeding” with humans
     …  Humans and Neanderthals may have .. collaborated artistically /18-02-25

    A.I. Is Getting Cheaper
     …  drone that can set a course entirely on its own
     …  to follow someone
     …  sort of a flying selfie stick. But
     …  $2,499 .. It was made with technological building blocks that are available to anyone: ordinary cameras, open-source software and low-cost computer chips.
     …  a new level of autonomy to cars, warehouse robots, security cameras and a wide range of internet services.
     …  today’s computer vision algorithms, for example, can be fooled into seeing things that are not there.
     …  Future of Humanity Institute
     …  all the less tangible ways that A.I. is being integrated into our lives
     …  The rapid evolution of A.I. is creating new security holes.
     …  Researchers are also developing A.I. systems that can find and exploit security holes in all sorts of other systems
     …  A.I. systems are increasingly adept at generating believable audio and video on their own.
     …  “Deepfakes,” which provides a simple way of grafting anyone’s head onto a pornographic video — or put words into the mouth of the president.
     …  an endless cat-and-mouse game between A.I. systems trying to create the fake content and those trying to identify it. /18-02-23

    fact-resistant humans
     …  Our research is very preliminary, but it’s possible that they will become more receptive to facts once they are in an environment without food, water, or oxygen /18-02-14

    two conceptions of humankind’s place in the cosmos
     …  early 16th century, when the Polish-German polymath Nicolaus Copernicus, drawing on data from Arab and Persian geometers
     …  had great impact on our conception of ourselves and our place in the cosmos.
     …  Unlike the first Copernican Revolution, the second happened rapidly and was largely the product of a single mind — Charles Darwin.
     …  We are not even at the heart of life on Earth
     …  It is the fate of every successful species to wipe itself out — that is the way things work in biology
     …  Is it so unlikely that our species, a congeries of changelings, would be able to transform our lives to meet new challenges? /18-02-08

    Paleolithic Parents
     …  According to the most recent cave drawings, children nowadays are using fire more than ever before.
     …  We adult Homo erectus, with our enlarged brains
     …  Establish clear but firm limits: Fire is nice, but there’s a time and a place for it.
     …  Remember, you’re the patriarch (or matriarch, depending on your community’s customs surrounding familial power structures), and you make the rules!
     …  For many children, fire is a harmless, pleasant addition to their lives. But for some it can become an all-consuming passion.
     …  ignoring people when they are in the same room as fire
     …  talking or thinking about fire, even when there is no fire present
     …  Anthropomorphization: talking to/interacting with the fire as if it were a sentient being
     …  introduce non-fire activities that the whole family can enjoy together /18-02-08

    Reason, Humanism, and Progress By Steven Pinker
     …  Pinker’s claim about the state of the world is little more than a statistically supported version of these obvious truths.
     …  Nor does he claim that the world is wonderful as it is.
     …  the future is not guaranteed to be good unless we continue to draw on the resources of science and reason that have taken us so far
     …  climate change poses a very serious risk
     …  For Pinker, almost all that we have today is thanks to the Enlightenment.
     …  humankind could begin to address its real problems with methods that worked
     …  that led to Auschwitz, or for the loss of spiritual values that leaves us with our shallow, materialistic, empty lives.
     …  religious resistance to the secularisation
     …  resistance to scientific overreach that dismisses as useless or superstitious anything that can’t be measured and tested
     …  Anglophone prejudice against modern European philosophy .. postmodernism /18-02-06

    Holocene temperatures
     …  the past 11,700 years
     …  sub-fossil pollen from 642 sites across North America and Europe closely match simulations, and that long-term warming, not cooling, defined the Holocene until around 2,000 years ago
     …  long-term cooling was limited to North Atlantic records
     …  climate models can adequately simulate climates for periods other than the present-day
     …  amplified warming in recent decades increased temperatures above the mean of any century during the past 11,000 years /18-02-01

    Early Middle Palaeolithic culture in India around 385–172 ka reframes Out of Africa models
     …  385±64 .. 172±41
     …  modern humans or archaic hominins
     …  complex interactions between local developments and ongoing global transformations /18-02-01

    pictorial mathematical language
     …  a new way to think about mathematics, through developing and using different mathematical languages based on pictures in two, three, and more dimensions
     …  Templeton Religion Trust
     …  Ultimately what higher-dimensional picture language does is to translate the structure of space into mathematics in a natural way /18-02-01

    Steven Pinker's .. Enlightment Now
     …  clear explanation of progress
     …  reason, science, and humanism
     …  Our world today encourages abstract thought from a young age, and it’s making us smarter.
     …  a bit too optimistic about artificial intelligence .. Bill Gates /18-01-31

    From the Mississippi Delta to Krakow’s old town
     …  to listen for the word Żyd—Jew—and to recognize when it was spoken in the same tone my father used when holding forth about Black people
     …  We made some of the best friends of our lives there, and I eventually found my own special spot, an outdoor café named Bunkier that figures prominently in my novel and offers fabulous views of Planty, the broad, green band ringing the Old Town. The café operates year-round: in cold weather, they lower clear plastic drop-panels and turn on space heaters. I spent countless hours there, sipping beer, reading and watching people stroll by.
     …  Somehow, I had come to belong to this country and this city, owning and being owned by them, as I had once owned and been owned by Mississippi. /18-01-31

    The Europeanization of Holocaust remembrance
     …  a new Polish law that would criminalize any suggestion that Poland was responsible for Nazi atrocities.
     …  Few facts of European history appear to be as widely known today as the following: the genocide against European Jews was initiated and implemented by Nazi Germany during the Second World War, and primary responsibility for the murder of its six million victims lies with the German state and society of the time.
     …  Europeanization has to confront serious obstacles. Comparisons between Nazi and Stalinist rule – i.e. comparisons that pay due attention to similarities as well as differences – have remained something of a taboo in Russia and have not been encouraged much, albeit for different reasons, in Germany either. /18-01-31

    Andrzej Franaszek Milosz, A Biography, Edited and translated by Aleksandra Parker, Michael Parker
    Harvard University Press /18-01-23

    evolution is more complex than we once assumed
     …  extended evolutionary synthesis (EES)
     …  whether what happens to organisms during their lifetime – their development – can play important and previously unanticipated roles in evolution.
     …  The way that genes are expressed to produce an organism’s phenotype – the actual characteristics it ends up with – is affected by chemicals that attach to them.
     …  Usually these so-called ‘epigenetic’ attachments are removed during the production of sperm and eggs cells, but it turns out that some escape the resetting process and are passed on to the next generation
     …  truly Lamarckian
     …  epigenetic inheritance pushes us to think about evolution in a different way
     …  social learning in mammals, birds, fish and insects
     …  Creationists and advocates of ‘intelligent design’ also feed this impression, with propaganda that exaggerates differences of opinion among evolutionists
     …  does all this mean a radically different and profoundly richer account of evolution is emerging? No one knows /18-01-23

    Beyond Falsifiability
     …  Sean Carroll .. attacking the naive Popperazi
     …  Ellis here is making the central argument that Carroll refuses to acknowledge: the problem with the multiverse is that it’s an empty idea, predicting nothing.
     …  Carroll .. The best reason for classifying the multiverse as a straightforwardly scientific theory is that we don’t have any choice. This is the case for any hypothesis that satisfies two criteria:
    It might be true.
    Whether or not it is true affects how we understand what we observe.
     …  various hypotheses about supreme beings and how they operate would by this criterion qualify as science.
     …  “M-theory” is a word but not an actual theory /18-01-23

    Novelty in science
     …  reproducibility crisis
     …  Balancing fresh findings and robustness
     …  measure of scientific novelty .. more novel if it cited a diverse combination of journals. For example, a scientific article citing a botany journal, an economics journal and a physics journal would be considered very novel if no other article had cited this combination of varied references before. /18-01-10

    Consciousness as a State of Matter
     …  “perceptronium”, with distinctive information processing abilities
     …  quantum factorization problem: why do conscious observers like us perceive the particular Hilbert space factorization corresponding to classical space (rather than Fourier space, say)
     …  Our approach generalizes Giulio Tononi’s integrated information framework for neural-network-based consciousness to arbitrary quantum systems, and we find interesting links to error-correcting codes, condensed matter criticality, and the Quantum Darwinism program, as well as an interesting connection between the emergence of consciousness and the emergence of time.
     …  it is striking that many of the most hotly debated issues in physics today involve the notions of observations and observers .. these issues have resisted resolution for so long is .. what constitutes an observer
     …  Is our persistent failure to unify general relativity with quantum mechanics linked to the different roles of observers in the two theories? .. observer in general relativity has no mass, no spatial extent and no effect on what is observed, whereas the quantum observer notoriously does appear to affect the quantum state of the observed system
     …  One might hope that a detailed observer definition will prove unnecessary because some simple properties such as the ability to record information might suffice
     …  Another commonly held view is that consciousness is unrelated to quantum mechanics because the brain is a wet, warm system where decoherence destroys quantum superpositions of neuron firing much faster than we can think, preventing our brain from acting as a quantum computer .. consciousness and quantum mechanics are nonetheless related, but in a different way: it is not so much that quantum mechanics is relevant to the brain, as the other way around. Specifically, consciousness is relevant to solving an open problem at the very heart of quantum mechanics: the quantum factorization problem.
     …  David Chalmers has termed “the hard problem” of consciousness
     …  non-physical element such as an “anima” or “soul”. Support for dualism among scientists has gradually dwindled with the realization that we are made of quarks and electrons
     …  Occam’s razor
     …  an arrangement of particles can feel conscious, we will start with the hard fact that some arrangement of particles (such as your brain) do feel conscious while others (such as your pillow) do not, and ask what properties of the particle arrangement make the difference.
     …  Giulio Tononi .. for an information processing system to be conscious, it needs to have two separate traits:
    1. Information: It has to have a large repertoire of accessible states, i.e., the ability to store a large amount of information.
    2. Integration: This information must be integrated into a unified whole, i.e., it must be impossible to decompose the system into nearly independent parts, because otherwise these parts would subjectively feel like two separate conscious entities. .. Integrated Information Theory (IIT)
     …  neural correlates of consciousness .. physical correlates of consciousness
     …  the future of artificial intelligence to determining when an animal, fetus or unresponsive patient can feel pain
     …  Principle - Definition:
    Information principle - A conscious system has substantial information storage capacity.
    Dynamics principle - A conscious system has substantial information processing capacity.
    Independence principle - A conscious system has substantial independence from the rest of the world.
    Integration principle - A conscious system cannot consist of nearly independent parts.
     Autonomy principle - A conscious system has substantial dynamics and independence.
     Utility principle - An evolved conscious system records mainly information that is useful for it.
     …  the information principle: by applying the Schrodinger equation to systems that could record and store information, he (Hugh Everet) inferred that they would perceive subjective randomness in accordance with the Born rule. /18-01-02

    Mind from matter
     …  View #1: "It's a mystery – that's all I can say." /Witten
     …  View #2: "There's no mystery – there's no mind, only matter."
     …  mental realm by simply denying it, or denying the validity of the question
     …  Eliminative Materialism
     …  You don't ask .. "What is the essence of the quark?"
     …  View #3: "Consciousness is a mysterious property that emerges in certain physical systems."
     …  epiphenomenon, a phenomenon outside of the causal order /18-01-02

    2017

    The christian destruction of the classical world
     …  the vandalism that took place between the mid AD 380s and AD 532 as Christianity grew to become the dominant religion
     …  Christians were told that they would reap the benefits in heaven if they became martyrs to the cause of destroying the existing beliefs.
     …  censorship
     …  the largest destruction of art that human history has ever seen
     …  the current political climate in the west has been created by politicians who are leading and/or competing to fall in line with populist movements which thrive on fear of the ‘other'
     …  lead to another ‘darkening age' /Catherine Nixey/17-12-25

    Life Could Have Begun In Space
     …  organic molecules could originate from space radiation interacting with icy surfaces
     …  low-energy electrons (LEEs)
     …  Propylene, ethane and acetylene developed in films of frozen methane, while ethanol developed in irradiated frozen methane and oxygen.
     …  building blocks of life could have come from space /17-12-20

    Is There a Limit to Scientific Understanding?
     …  Human brains evolved to be adaptable .. our ancestors roamed the savannah
     …  certain areas (such as atomic physics) to the point that there’s no more to say.
     …  we’ll reach the limits of what our brains can grasp.
     …  we aren’t aware of, any more than a monkey comprehends Darwinism or meteorology.
     …  Some insights might have to await a post-human intelligence.
     …  Today, we can convincingly interpret measurements that reveal two black holes crashing together more than a billion light-years from Earth.
     …  Atoms and astronomical phenomena—the very small and the very large—can be quite basic. It’s everything in between that gets tricky. Most complex of all are living things.
     …  Mathematics is in the basement, followed by particle physics, then the rest of physics, then chemistry, then biology, then botany and zoology, and finally the behavioral and social sciences (with the economists
     …  Scientists are nearly all reductionists .. everything, however complex, is a solution to Schrödinger’s equation
     …  More is different .. hurricanes, human societies—is made of atoms
     …  “emergent” properties
     …  reductionism is true in a sense. But it’s seldom true in a useful sense
     …  the very small, the very large, and the very complex
     …  Efforts to understand very complex systems, such as our own brains, might well be the first to hit such limits.
     …  Physicists might never understand the bedrock nature of space and time because the mathematics is just too hard.
     …  David Deutsch .. The Beginning of Infinity (2011)
     …  Whether the machines will eventually surpass us to a qualitative degree—and even themselves become conscious—is a live controversy.
     …  Abstract thinking by biological brains has underpinned the emergence of all culture and science. But this activity, spanning tens of millennia at most, will probably be a brief precursor to the more powerful intellects of the post-human era—evolved not by Darwinian selection but via “intelligent design.” /17-12-19

    central nervous system evolved independently several times
     …  Xenoturbella bocki, a firm favourite in the scientific community
     …  Similar gene expression underscored the concept that the cords could be traced back to a common ancestor. But
     …  the truth is more nuanced. “There are probably some components [of the central nerve cord] that are maintained from ancient evolutionary times," he says, "and some that are layered on top of that.” /17-12-19

    Edward Witten
     …  dualities in physics and math, emergent space-time, and the pursuit of a complete description of nature
     …  M-theory, the leading candidate for a unified physical “theory of everything”
     …  M-theory incorporates within a single mathematical structure all five versions of string theory
     …  “it from qubit”
     …  space-time and everything in it emerges like a hologram out of information stored in the entangled quantum states of particles
     …  You can’t imagine it at all? No, I can’t.
     …  How would you describe what’s real or fundamental? What aspect of what’s real are you interested in? What does it mean that we exist? Or how do we fit into our mathematical descriptions?
     …  Do you have any ideas about the meaning of existence? No. [Laughs.] /17-12-18

    Sean Carroll: From the Big Bang to the meaning of life/17-12-14

    Anthropocene/17-12-11

    CO2 could soon reach levels that, it’s widely agreed, will lead to catastrophe.
     …  Carbon-dioxide removal is, potentially, a trillion-dollar enterprise because it offers a way not just to slow the rise in CO2 but to reverse it.
     …  the power generated by a Nigeria-size solar farm would be enough to remove all the CO2 emitted
     …  Carbon dioxide should be regarded the same way we view other waste products, like sewage or garbage. We don’t expect people to stop producing waste.
     …  Petra Nova plant, near Houston, uses post-combustion carbon capture on a large scale
     …  carbon dioxide removal .. It may be impossible to manage and it may also be impossible to manage without. /17-11-15

    Can a Robot Join the Faith?
     …  The recent awarding of Saudi citizenship to an android named Sophia raises a strange and unexpectedly pressing theological question.
     …  Neom .. international trade center, built from scratch, .. five hundred billion dollars, on the shores of the Red Sea .. the future of human civilization .. inhabited by armies of artificially intelligent bots
     …  Sophia is a chatty A.I. android born of the Hanson Robotics lab, in Hong Kong. In conversation, she will look you in eye in order to memorize your face
     …  sixty-two facial expresssions
     …  she learns constantly
     …  she even managed to output some witticisms about not destroying humankind.
     …  modelled after Audrey Hepburn
     …  Sophia Robot might, in theory, be considered Muslim, or Christian, or Jewish, or Buddhist, or Jain? .. could a robot serve as .. Pope?
     …  one day in the not-so-distant future, the Internet will suddenly coalesce into a super-intelligent A.I., infinitely smarter than any of us individually and all of us combined; it will become alive in the blink of an eye, and take over the world before humans even realize what’s happening. .. around 2040
     …  when the Singularity comes to pass, and the bots write their own bibles, the more pressing question may not be whether bots can join our religions but what place we will have in theirs. /17-11-15

    Trolley Problem
     …  designed to test our moral intuitions and introduce the differences between Kantian and consequentialist reasoning
     …  Most people announce that they would pull the switch
     …  The persistence of the trolley problem in philosophy and psychology tells us a lot more about the state of those fields than it does about ourselves and our moral choices.
     …  The Good Place
     …  every single answer is horrific, and wild examples like this take us so far afield from ordinary moral choices that they’re close to nonsensical
     …  “If you had to kill one of your parents, which one would it be?”
     …  what the trolley problem largely shows is that it’s very easy to temporarily become a psychopath if your professor says doing so will be intellectually useful
     …  to program collision avoidance algorithms for driverless cars
     …  trolley problem is not just a pointless exercise. It could also be a damaging one, because of the way in which it gets students to start thinking about moral questions. /17-11-08

    human biases in science
     …  it seems surprising that science functions at all
     …  Brian Nosek .. “motivated reasoning”
     …  Karl Popper .. falsify her theories—to ask “How am I wrong?” .. instead “How am I right?”
     …  Researchers, like people generally, are bad at thinking about probabilities
     …  Given that science has uncovered a dizzying variety of cognitive biases, the relative neglect of their consequences within science itself is peculiar
     …  much more likely to publish positive than negative results
     …  I could be patient, or get lucky—or I could take the easiest way, making often unconscious decisions about which data I select and how I analyze them, so that a clean story emerges.
     …  Although scientists guard the status quo, they also have the power to change it. /17-11-08

    Should we be afraid of AI? Machines seem to be getting smarter and smarter and much better at human jobs, yet true AI is utterly implausible.
     …  Good’s ‘intelligence explosion’
     …  Stephen Hawking in 2014: The development of full artificial intelligence could spell the end of the human race.
     …  Bill Gates .. Elon Musk .. We should be very careful about artificial intelligence.
     …  Tay – an AI-based chat robot .. it quickly became an evil Hitler-loving, Holocaust-denying .. absorbing and being shaped by the nasty messages sent to it. Microsoft apologised.
     …  disbelievers as members of the Church of AItheists
     …  good philosophy is almost always in the boring middle
     …  Singularitarians .. close-enough-to-worry-about but far-enough-not-to-be-around-to-be-proved-wrong
     …  a digital opiate for the masses
     …  What we are going to see are increasingly smart machines able to perform more tasks that we currently perform ourselves.
     …  AI is just computers, computers are just Turing Machines, Turing Machines are merely syntactic engines, and syntactic engines cannot think, cannot know, cannot be conscious. End of story
     …  True AI is not logically impossible, but it is utterly implausible.
     …  so-called undecidable problems .. it is impossible to construct an algorithm that always leads to a correct yes-or-no answer.
     …  Quantum computers are constrained by the same limits
     …  We are not at the centre of the Universe (Copernicus), of the biological kingdom (Charles Darwin), or of rationality (Sigmund Freud). And after Turing, we are no longer at the centre of the infosphere, the world of information processing and smart agency, either.
     …  We thought we were free because we could buy whatever we wished. Now our spending patterns are predicted by devices as thick as a plank. /17-11-06

    Randomness of Language Evolution
     …  English is shaped by more than natural selection
     …  Today, if you wanted to talk about something that’s clear, you’d say that it has clarity. But if you were around in 1890, you would almost certainly have talked about its clearness.
     …  the evolution of languages and of species. Darwin himself wrote about these “curious parallels”
     …  “The survival ... of certain favored words in the struggle for existence is natural selection,” Darwin wrote
     …  genes can also change in frequency for completely random reasons .. pure, dumb luck .. drift
     …  Random processes are simply underappreciated, because we want to come up with interesting explanations. /17-11-03

    Martin Luther
     …  Five hundred years .. 95 .. Wittenberg
     …  splitting the thousand-year-old Roman Catholic Church into two churches
     …  hammering episode, so satisfying symbolically—loud, metallic, violent—never occurred .. he sent it to the local archbishop
     …  The quintessentially modern idea of the individual was as unthinkable before Luther
     …  he was vehemently anti-Semitic
     …  Most painful, it seems, for this passionately religious young man was to discover his anger against God.
     …  forgiven x amount of time in Purgatory
     …  This made his texts easy and pleasing to read aloud, at home, to the children.
     …  woodcut illustrations, all by one artist from the Cranach workshop
     …  the only book in the house /17-10-30

    AlphaGo mastered the game with no human input
     …  The computer program even devised new strategies previously unknown to human players
     …  AlphaGo Zero trained solely through self play, starting with completely random moves. After a few days’ practice, AlphaGo Zero trounced AlphaGo Lee 100 games to none, researchers report in the Oct. 19 Nature.
     …  computer programs with superhuman smarts could find new cures for diseases
     …  For each turn, AlphaGo Zero drew on its past experience to predict the most likely ways the rest of the game could play out, judge which player would win in each scenario and choose its move accordingly.
     …  AlphaGo Lee used this kind of forethought in matches against other players, but not during practice games.
     …  AlphaGo Zero’s ability to imagine and assess possible futures during training
     …  AlphaGo Zero not only discovered many of the Go strategies that humans have come up with over thousands of years, but also devised new game plans previously unknown to human players.
     …  AlphaGo Zero is still “an idiot savant” that can’t do anything except play Go
     …  they’ll have to be more general-purpose problem-solvers /17-10-30

    smart appliances are revolutionizing commerce
     …  Internet of Things
     …  not to mention light bulbs, sex toys, toilets, pet feeders, and a children’s thermos
     …  Alexa .. Amazon has been learning when some customers wake up, go to work, listen to the news, play with their kids, and go to sleep.
     …  a fundamental shift in the relationship between customers and companies
     …  when an appliance is sending a constant stream of data back to its maker
     …  to push prices as low as possible in order to build your customer base /17-10-17

    Wystąpienie Prezesa Polskiej Akademii Umiejętności podczas Narodowego Kongresu Nauki
     …  głęboka przepaść pomiędzy światem humanistów a światem przyrodników i techników
     …  nauka gwałtownie traci zaufanie społeczne
     …  Polaków, nie mając elementarnej wiedzy o regułach organizacji państwa, a także o podstawowych procesach społecznych, bez trudności daje się manipulować politykom. Z drugiej strony, nie umiejąc odróżnić nauki od magii
     …  METODA NAUKOWA
     …  znaczenie problemu „dwóch kultur”
    /Andrzej Białas, PAUza Akademicka Nr 397 /17-10-13

    Big Melt, Not a Big Bang
     …  The cosmological constant and the creation of the universe
     …  10-123
     …  magnitude of initial perturbations
     …  totally lack predictive power
     …  theorists still not merged gravity and quantum theory
     …  cosmogenesis—the creation of the universe
     …  the information content of cosmic spacetime
     …  hypothetical pre-geometric phase of the universe, in which notions of space and time have not yet-emerged from some as-yet unknown structure
     …  information should play a key role in the description of physics
     …  holography
     …  Spacetime should be thought of as made of microscopic degrees of freedom, just as matter is made of atoms.
     …  CosmIn, being a physical observable number, must be finite.
     …  CosmIn is indeed 4π
     …  The conventional approach must consider this result as a random numerical coincidence. We, on the other hand, believe it is telling us something deep and beautiful about our universe.
     …  to link the numerical value of the cosmological constant to the size of the fluctuations in the early universe
     …  The notion of a Big Bang is completely eliminated, and replaced by a transition from one phase to another at the boundary. And the need for an inflationary period in the universe’s early history is also eliminated.
     …  spacetime is made of more elementary degrees of freedom—just as matter is made of atoms /17-10-09

    Aliens in our midst
     …  The ctenophore was already known for having a relatively advanced nervous system; .. its nerves were constructed from a different set of molecular building blocks – different from any other animal – using ‘a different chemical language’ .. these animals are ‘aliens of the sea’.
     …  This animal, the ctenophore, provides clues to how evolution might have gone if not for the advent of vertebrates, mammals and humans,
     …  how different from one another brains can be
     …  The tendency of complex nervous systems to evolve is probably universal
     …  All animals were sons and daughters of a single moment of evolutionary creation: the birth of the nerve cell.
     …  the first brain must have appeared quite early, before the ancestors of insects and vertebrates parted evolutionary ways. If this was true, then the 550 to 650 million years
     …  The ctenophore seemed to follow an entirely different evolutionary pathway
     …  the ctenophore lacked several classes of general body-patterning genes that were thought to be universal to all animals
     …  proteins and molecules was blindly chosen, through random gene duplication and mutation, to take part in building a nervous system
     …  scientists speculate what kind of life might exist on other worlds
     …  life might have arisen two or more times on our planet
     …  Ctenophores are a long-lost cousin that we didn’t even know we had. /17-10-05

    Those 3% of scientific papers that deny climate change?
     …  A review found them all flawed
     …  Theoretical and Applied Climatology
     …  The researchers tried to replicate the results of those 3% of papers—a common way to test scientific studies—and found biased, faulty results.
     …  very single one of those analyses had an error—in their assumptions, methodology, or analysis—that, when corrected, brought their results into line with the scientific consensus
     …  Many had cherry-picked the results that conveniently supported their conclusion, while ignoring other context or records.
     …  inappropriate “curve-fitting”
     …  even contradicting each other /17-10-05

    Absurdity of the Nobel Prizes in Science
     …  They distort the nature of the scientific enterprise, rewrite its history, and overlook many of its most important contributors.
     …  three-page-long author list
     …  misleading impression of how a lot of science is actually done
     …  usually reserved for Oscar or Emmy nominees /17-10-05

    0.05
     …  make it tougher to call findings statistically significant
     …  The statistic is used to test a ‘null hypothesis’, a default state positing that there is no relationship between the phenomena being measured. The smaller the P value, the less likely it is that the results are due to chance — presuming that the null hypothesis is true. Results have typically been deemed ‘statistically significant’ — and the null hypothesis dismissed — when P values are below 0.05.
     …  this threshold should be reduced to 0.005
     …  researchers should select and justify P value thresholds for their experiments, before collecting any data
     …  there isn’t a single magic number /17-09-27

    deep neural networks
     …  Experts wonder what it is about deep learning that enables generalization — and to what extent brains apprehend reality in the same way.
     …  a new theory explaining how deep learning works
     …  information bottleneck
     …  the most important part of learning is actually forgetting
     …  information theory wasn’t the right way to think about relevance, starting with misconceptions that go all the way to Shannon himself
     …  define ‘relevant’ in a precise sense
     …  compressing X as much as you can without losing the ability to predict Y
     …  deep learning proceeds in two phases: a short “fitting” phase, during which the network learns to label its training data, and a much longer “compression” phase, during which it becomes good at generalization, as measured by its performance at labeling new test data.
     …  The mystery of how brains sift signals from our senses and elevate them to the level of our conscious awareness
     …  fears that AI could someday pose an existential threat
     …  general insights about learning and intelligence /17-09-27

    Truth?
     …  a big abstract noun – truth – is at the heart of a cultural crisis
     …  Alfred Tarski’s famous example from the 1930s, “Snow is white” is true if and only if snow is white.
     …  True beliefs took humans to the moon, false ones led to a space shuttle exploding shortly after take-off.
     …  trust in religious texts and leaders, learned experts and the enduring folk wisdom called common sense
     …  Now, it seems, virtually nothing is universally taken as an authority.
     …  Picasso’s famous aphorism “Art is a lie that makes us realize truth”.
     …  believers have retorted that religion is concerned with a different kind of truth from that of science and so cannot be falsified by it .. Stephen J. Gould .. “Non-Overlapping Magisteria”
     …  Christ’s tomb was found empty .. It’s a rare Christian who says this doesn’t matter at all.
     …  Truth is not relative, but we relate to it in innumerable ways. /17-09-24

    Tectonic Coincidence of Mexico’s
     …  whether the two temblors—on September 8th and 19th—were connected
     …  both exceptions to some general geophysical rules
     …  classic subduction-zone events. In fact, neither was
     …  megathrust events
     …  to distinguish causality from coincidence /17-09-24

    Philosophy as the Las Vegas
     …  Philosophy is always going to be the default home of non-naturalists and anti-naturalists. Since no other discipline will take them seriously
     …  What happens in Vegas stays in Vegas!
     …  it’s philosophy, and who takes that seriously?
     …  whether the universe was created exactly six minutes ago
     …  sort of quarantine barrier between philosophers' doscourses and the general run
     …  Philosophy at its best is informed play of the highest orderand a propre ingredient in any naturalistic vision of inquiry. /Daniel C. Dennett/17-09-23

    From galaxies far far away!
     …  cosmic rays with individual energies of several Joules
     …  rate of arrival of cosmic rays is ~6% greater from one half of the sky than from the opposite one,
     …  outside the Milky Way
     …  only about 1 per sq km per year
     …  5.2 standard deviations (a chance of about two in ten million) /17-09-23

    the Prettiest
     …  Fancy feathers or (in humans) symmetrical faces have been cast not as instruments of sexual selection, but as “honest signals” of some greater underlying fitness.
     …  Genes, rather than traits, became what natural selection selected.
     …  Richard Prum .. THE EVOLUTION OF BEAUTY
     …  this “aesthetic” courtship, says Prum, creates an environment, temperaments and rituals — a sort of culture — that give the female sexual choice, autonomy and safety.
     …  selecting for males who allow females autonomy and choice.
     …  catalog of Things Natural Selection Can’t Explain but Sexual Selection Easily Can includes homosexuality, a tendency toward monogamy, both sex’s taste and capacity for sex outside of female fertility periods
     …  When sex offers orgasm at relatively low pregnancy risk, it provides a way not just to reproduce but to assess potential mates’ attention to female desires, tastes and choices.
     …  This is why beauty should not be seen as merely the stamp of quality assurance that conventional evolutionary theory thinks it is. Beauty, rather, forms the foundation of an entire, complex evolutionary dynamic — one that can influence how we treat each other. /17-09-23

    Meditation
     …  Examining the science and supernaturalism of Buddhism
     …  it is helpful and therapeutic
     …  practicing Vipassana, or “insight” meditation
     …  Buddha is conceived as a wise man and self-help psychologist, not as a divine being
     …  This nimble-footed doubleness may indeed hold profound existential truths
     …  The sitter becomes less selfish and more selfless.
     …  Buddhist doctrine and practice anticipate and affirm the “modular” view of the mind favored by much contemporary cognitive science. Instead of there being a single, consistent Cartesian self that monitors the world and makes decisions, we live in a kind of nineties-era Liberia of the mind, populated by warring independent armies implanted by evolution, representing themselves as a unified nation but unable to reconcile their differences, and, as one after another wins a brief battle for the capital, providing only the temporary illusion of control and decision.
     …  the fixed self is an illusion imprinted by experience
     …  Meditation .. is not a metaphysical route toward a higher plane.
     …  Whether or not evolutionary psychology is a real or a pseudoscience—opinions vary
     …  Christianity try to tiptoe past the doctrines of Heaven and Hell, so that Hell becomes “the experience of being unable to love,” or Heaven a state of “being one with God”
     …  why a scientific explanation of that kind has seldom arisen in Buddhist cultures.
     …  meditation practice—the draining away of the stories we tell compulsively about each moment in favor of simply having the moment
     …  Can any old faith point a new way forward?
     …  A faith practice with an authoritarian structure sooner or later becomes a horror; a faith practice without an authoritarian structure sooner or later becomes a hobby. /17-09-13

    W Traktacie o malarstwie Leonardo da Vinci udziela młodemu adeptowi sztuki malarskiej takiej oto rady:
     …  nie zawadzi zatrzymać się czasem, by obserwować plamy na murach albo popiół ogniska, albo chmury czy błoto, albo inne podobne rzeczy. Jeśli będziesz w nie patrzył, znajdziesz tam czarujące pomysły, pobudzające umysł malarza do nowych pomysłów, tak do kompozycji bitew, zwierząt, ludzi, jak do rozmaitych układów krajobrazu i rzeczy potwornych, jak diabły i tym podobne. Przysporzy ci to sławy. Albowiem rzeczy pogmatwane pobudzają umysł do nowych inwencji. /Jakub Jernajczyk Portrety przypadku/17-09-13

    facial recognition
     …  THE human face is a remarkable piece of work.
     …  is crucial to the formation of complex societies.
     …  the face’s ability to send emotional signals
     …  In America facial recognition is used by churches to track worshippers’ attendance
     …  Apple’s new iPhone is expected to use it to unlock the homescreen
     …  Facebook’s bank of facial images cannot be scraped by others, but the Silicon Valley giant could obtain pictures of visitors to a car showroom, say,
     …  China’s government keeps a record of its citizens’ faces
     …  to track criminals, but at enormous potential cost to citizens’ privacy.
     …  one gay man, and one straight man, the algorithm could attribute their sexuality correctly 81% of the time. Humans managed only 61%
     …  If your partner can spot every suppressed yawn, and your boss every grimace of irritation, marriages and working relationships will be more truthful, but less harmonious.
     …  Relationships might become more rational, but also more transactional.
     …  Change is coming. Face up to it. /17-09-11

    Cassini’s 13 years of stunning Saturn science
     …  in pictures
     …  Twenty years ago .. Florida morning
     …  3.5-billion-kilometre journey and 13 years spent circling Saturn
     …  Geysers on Enceladus spray water vapour and ice mixed with organic molecules into space.
     …  Sunlight glints off lakes of liquid hydrocarbons on Titan.
     …  Saturn's 60-plus moons
     …  Just 100 metres or so thick, Saturn’s rings are shaped by many moons and moonlets embedded within.
     …  The moon Pan clears a pathway within the rings known as the Encke Gap.
     …  Thunderclouds barrelled across Saturn’s northern hemisphere in 2010–11.
     …  the mission will come to a close soon /Nature/17-09-02

    717 million years ago, the Earth turned into a snowball
     …  Volcanoes released enough carbon dioxide
     …  The algae, in turn, revolutionized the food webs in the sea
     …  oxygen in the planet’s atmosphere
     …  steranes, which are found in algal cells, and hopanes, which are found in bacterial cells
     …  When phosphate levels are low, bacteria do better than algae
     …  When the planet warmed, increased rainfall hit the newly exposed ground and washed even more phosphate seaward.
     …  635-million-year mark, at the dawn of the Ediacaran period, centimeter-sized organisms showed up.
     …  the rise of algae led to the rise of animals /17-08-28

    universal basic income
     …  Adopting a universal basic income for all people can help society think creatively with new ideas, develop new industries — and free-up people to work on important future projects. This practical social support program can grow as science & technology rapidly evolve, becoming part of world abundance. .. Ray Kurzweil
     …  Mark Zuckerberg .. a renewed sense of purpose .. Our generation will have to deal with tens of millions of jobs replaced by automation like self-driving cars
     …  We’re all going to make mistakes, so we need a society that focuses less on locking us up or stigmatizing us.
     …  We are clearly headed toward a situation where everyone can live very well
     …  The fantastic price-performance gains we’ve seen in information technology is coming to physical products, food, energy /17-08-28

    Odds for Lucky Mutations
     …  SOS response, a DNA repair mechanism that bacteria employ when their genomes are damaged, during which dozens of genes become active and the rate of mutation goes up. Those extra mutations are more often detrimental than beneficial, but they enable adaptations
     …  Is the upsurge in mutations merely a secondary consequence of a repair process inherently prone to error? Or, .. is the increase in the mutation rate itself an evolved adaptation
     …  harsh environments cause nonrandom mutations
     …  It has also been to find a plausible mechanism consistent with the rest of molecular biology that could make lucky mutations more likely.
     …  more mutation specifically in regions of the yeast genome where it could be most adaptive
     …  are mutations always random?
     …  variation in the number of gene copies might be a response to stresses or hazards in the environment
     …  purposefully adaptive response
     …  The small number of cells that did the right thing were at such an advantage that they were able to outcompete everything else
     …  They may also seem reminiscent of the outmoded, pre-Darwinian ideas of .. Lamarck
     …  mechanism that has arisen entirely through Darwinian selection of random mutations
     …  The Adaptive Mutation Debate
     …  they can adapt by elevating their mutation rate to promote genetic change.
     …  evolution can get speeded up
     …  chemotherapy-resistant cancers /17-08-28

    Hackers Are the Real Obstacle for Self-Driving Vehicles
     …  adversarial machine learning
     …  Super-Smart Cyberattacks
     …  today Windows is one of the most secure operating systems
     …  autonomous vehicles rely on complex machine-learning algorithms that are not well understood
     …  face recognition algorithms could be defeated by wearing a pair of clear glasses with a funky pattern printed on their frames
     …  It will take only a few accidents to stop the deployment of driverless vehicles. /17-08-24

    death of the internal combustion engine
     …  HUMAN inventiveness…has still not found a mechanical process to replace horses .. in December 1893
     …  The big end
     …  Rapid gains in battery technology
     …  “total cost of ownership” of an electric car will reach parity with a petrol one next year—albeit at a loss to its manufacturer.
     …  Britain joined a lengthening list of electric-only countries, saying that all new cars must be zero-emission by 2050
     …  electric cars are much simpler
     …  Assuming, of course, that people want to own cars at all.
     …  self-driving technology .. could shrink the industry by as much as 90%
     …  Saudi Arabia, with vast reserves that can be tapped cheaply, will be under pressure to get pumping before it is too late
     …  lithium-rich Chile the new Saudi Arabia? Not exactly, because electric cars do not consume it
     …  still dominate shipping and aviation
     …  Driverless electric cars in the 21st century are likely to improve the world in profound and unexpected ways, just as vehicles powered by internal combustion engines did in the 20th. /17-08-10

    From Bacteria to Bach and Back
     …  qualia
     …  For Dennett this apparent irreducibility – philosophers call it “the hard problem” – is a false distinction.
     …  Consciousness is a system property, and is not reducible: he takes issue with those hard-line molecular biologists, notably DNA pioneer Francis Crick, who seek to locate consciousness in particular ensembles of neurons in specific brain regions. Such ensembles, Dennett argues, are mini-robots, competent in their functions, but only their interactions within the totality of the brain enable comprehension, and with it the “user illusion” that we all share, of being a person in charge of these processes.
     …  Here, his principal target is Chomsky, who has always insisted on the uniqueness and universality of human language. As Chomsky points out, language is unlike any other evolved human feature.
     …  the origins of language lie in the social nature of humans and come from the necessity of communicating
     …  Memes are, for Dennett, units of cultural transmission.
     …  Civilisation .. is a work in progress. It may die, returning the planet to the bacteria, or, .. The future is open. /17-08-08

    brain interventions to treat disease change the essence of who we are
     …  minds are dependent on brain
     …  we’ve been largely powerless to affect the way that brains work, at least in a systematic way
     …  neuroscientists have now started to develop novel methods of intervening in brain function
     …  they may put pressure on some basic beliefs and concepts that have been fundamental to how we view the world
     …  growing array of psychopharmaceuticals
     …  direct or transcranial electrical stimulation of cortex, magnetic induction of electrical activity, and focal stimulation of deep brain structures
     …  Transgenic manipulations
     …  to correct some neurodevelopmental problems in utero
     …  over 100,000 cyborgs are already walking among us, in some sense powered by or controlled by the steady zapping of their brain circuits with electrical pulses
     …  Deep brain stimulation
     …  neuroscience answers push us toward philosophy questions
     …  exploration of the truth about our brains and our selves
     …  Is there some immutable kernel of a person that is the self, or an essence that resists change?
     …  what have previously seemed like the abstract puzzles of philosophers may soon be seen to hit closer to home /17-08-07

    Dinosaurs
     …  66.1 million years ago .. K/Pg (Cretaceous-Palaeogen)
     …  It was not until 2013 that we had sufficiently precise datings for the impact and the extinctions to be sure that they really coincided
     …  We can roughly locate the impact by the thickness of the boundary layer.
     …  Chicxulub crater
     …  tsunami produced by the impact
     …  landed at a speed of some 40,000 miles an hour into the shallow sea
     …  10 billion Hiroshimas
     …  About nine miles across
     …  The initial impact would dig a hole 20 miles deep, and 120 miles across. Deep rock would rise as high as the Himalayas, and then collapse to form the observed impact ring, all within 10 minutes. The impact fireball would kill everything within a 600 mile radius. A shock wave would spread out through the solid earth, and a monstrous tsunami through the oceans. The atmosphere would have seen hurricane force winds, and rock condensing in the upper atmosphere would produce a rain of tiny glass spheres
     …  Edelman Fossil Park in New Jersey .. sudden indiscriminate killing
     …  the missing gypsum must have been destroyed by the heat of the impact, sending sulphur dioxide gas up into the atmosphere
     …  Extrapolating from Mt Pinatubo and other recent eruptions
     …  to reduce temperatures worldwide by more than 10C, while acid rain would also have contributed to the death of much marine life
     …  Where did those ten minutes come from? .. the asteroid would have missed the shallow gypsum-rich continental shelf
     …  Who survived? Small creatures able to feed on insects and seeds, not dependent on the products of day-by-day photosynthesis. /17-08-07

    humankind has never had it so good
     …  Brexit .. Donald Trump
     …  the proportion of the world’s population living in extreme poverty had fallen below 10% for the first time; global carbon emissions from fossil fuels had failed to rise for the third year running; the death penalty had been ruled illegal in more than half of all countries
     …  by many measures, “2016 was the best year in the history of humanity”
     …  the promise of artificial intelligence
     …  the New Optimists
     …  that it is best explained as the result of various psychological biases that served a purpose on the prehistoric savannah – but now, in a media-saturated era, constantly mislead us
     …  As recently as 1882, only 2% of homes in New York had running water; in 1900, worldwide life expectancy was a paltry 31
     …  The New Optimists invite us to forget our partisan biases and tribal loyalties
     …  Just look at the numbers!
     …  Steven Pinker
     …  it is scientific progress, he argues, that is destined to make us ever more ethical
     …  overconfidence
     …  Trump .. at some point, the damage may not be repairable
     …  the things that drive progress are not political /17-08-06

    Sean Carroll's attempt to construct morality out of quantum field theory
     …  The Big Picture: On the Origins of Life, Meaning, and the Universe Itself
     …  I don't think I have ever read anything with a bigger ambition
     …  “Our values,” writes Carroll, “have not yet caught up to our best ontology.” In this book, he conducts a quest to catch up.
     …  Quantum field theory provides a unified perspective on the subatomic realm. Carroll calls that the “Core Theory”
     …  the absurdity of adding to the Core Theory to explain the possibility of things such as an afterlife or a transcendent underlying purpose
     …  Like entropy, he argues, consciousness is a concept that “we invent to give ourselves more useful and efficient descriptions of the world”.
     …  “poetic naturalism”
     …  Carroll confidently defines many concepts, including belief and consciousness, as if 2,500 years of philosophy have yielded little relevant to the subject
     …  “ontologically fastidious”
     …  Morality exists only insofar as we make it so
     …  time, he means the quantity that scientists measure
     …  Carroll's is a naturalistic metaphysics. /17-08-06

    Ravens have paranoid, abstract thoughts about other minds
     …  The ability to think abstractly about other minds is singled out by many as a uniquely human trait. Now,
     …  Theory of Mind
     …  The ability to hide food is extremely important to ravens, and they behave completely differently when they feel they are being watched
     …  Completing this evolutionary and developmental picture will bring us much closer to figuring out what's really unique about the human mind /17-07-21

    Time
     …  There might be some pre-geometry, that would give rise to geometry just like atoms give rise to the continuum of elastic bodies.
     …  The flow of time is an illusion
     …  there are intervals of time between different events; that’s what clocks measure.
     …  it’s a feeling we have, but it’s not a property of time itself.
     …  Time doesn’t flow. That’s part of psychology.
     …  even space-time itself is a product of the special early stage of the universe. We don’t know that.
     …  the ultimate origin of the arrow of time, which is the asymmetry of the world in time, is still a bit contentious.
     …  there’s still experiments can be done in particle physics that might disclose this time-reversal asymmetry which is there in the weak interaction, and how that fits in with the arrow of time. /17-07-21

    the brain creates a representation in our heads of the world around us
     …  consciousness
     …  the idea that experience, and in particular color, is all generated in the brain—leads to some sloppy science
     …  The question of what’s “there” or what’s “now” is complex.
     …  Neuroscientists can’t disprove it, or prove that the experience is “generated” in the head.
     …  Rather than doing any real science, we are hearing fantasies about downloading consciousness into computers and the like. /17-07-21

    Trump’s speech at Krasinski Square, in Warsaw, boosted Poland’s ruling right-wing party but produced few other tangible results.
     …  Jarosław Kaczyński, the Party’s leader, touted Trump’s visit as a “new success” for Poland
     …  a method from the old Communist playbook
     …  free bus rides to Warsaw
     …  “Poles for Poland.”
     …  Copernicus, Chopin, and John Paul II
     …  Poland will be free now. /17-06-08

    Bitcoin
     …  the boom in bitcoin, a digital currency, is extraordinary
     …  If bitcoin and the other cryptocurrencies are unlike anything else, what are they?
     …  how to maintain a public database (the “blockchain”) without anybody in particular, a bank, say, being in charge
     …  decentralised upstarts taking aim at today’s oligopolistic technology giants, such as Amazon and Facebook /17-06-30

    Distance Between Language and Truth
     …  Radio is a spectral art, transmitted through the air; its pure aurality disembodies the teller and the tale.
     …  People, too, he says, can’t always been seen because “one day they die.” Reality, it seems, is full of holes.
     …  Not seeing becomes a kind of Cartesian believing.
     …  an artist whose vision is limited to what is right in front of him, literally outside his window. He suffers a crisis of faith, questioning the value of “looking more precisely” at certain objects /17-06-30

    Do parents really matter?
     …  Thomas Bouchard
     …  separating identical twins at birth
     …  Their characters were often remarkably in step, as were their intellects, their behaviours, even their hobbies and eccentricities.
     …  parenting influences — are all secondary when it comes to personality, behaviour or intelligence
     …  Steven Pinker .. ‘A cosmic ray mutates a stretch of DNA, a neurotransmitter zigs instead of zags, the growth cone of an axon goes left instead of right, and one identical twin’s brain might gel into a slightly different configuration from the other’s.’ In other words, we should not presume that random chance plays a vanishingly small role in making us the people that we are today.
     …  We may not hold their tomorrows in our hands but we surely hold their todays
     …  Pinker, meanwhile, makes the point that it should be enough for us to remember that our children are human beings, worthy of the same ethical treatment we give to our friends, other relatives, and even to strangers. So protect your children, provide for them, be good to them, and make memories with them. Apart from that, don’t expect to have very much say in how they turn out. /17-06-18

    Computers are starting to reason like humans
     …  A new type of neural network can reason about complex relationships
     …  Google’s DeepMind
     …  it has already beaten humans at a complex image comprehension test
     …  Statistical AI, or machine learning, is great at pattern recognition, but not at using logic.
     …  symbolic AI can reason about relationships using predetermined rules, but it’s not great at learning on the fly
     …  to bridge the gap
     …  forcing the network to discover the relationships that exist between the objects
     …  “There is an object in front of the blue thing; does it have the same shape as the tiny cyan thing that is to the right of the gray metal ball?”
     …  other machine-learning algorithms were right 42% to 77% of the time. Humans scored a respectable 92%. The new relation network combo was correct 96%
     …  “Sandra picked up the football” and “Sandra went to the office.” These were followed by questions like: “Where is the football?” (the office)
     …  “Lily is a Swan. Lily is white. Greg is a swan. What color is Greg?” (white)
     …  heir approach is .. conceptually quite simple
     …  That simplicity .. allows it to be combined with other networks
     …  toward models that come up with their own strategy /Science/17-06-16

    Machine learning
     …  If we want to numerically tackle some quantum problem .. we first need to find an efficient representation
     …  It is a new way of solving intractable, interacting quantum many-body problems that uses machine learning tools to find exact solutions
     …  to prove some mathematical facts about the families of quantum states represented by neural networks
     …  to simulate a quantum computer with an ordinary computer /17-06-16

    Augustine
     …  The Invention of Sex
     …  He rescued Adam and Eve from obscurity, devised the doctrine of original sin—and the rest is sexual history
     …  something fundamentally damaged about the entire human species
     …  In the “Confessions,” written around 397, Augustine described what happened in the bathhouse many years earlier.
     …  intense and equally cryptic phrases evoke a succession of unhappy affairs with women
     …  his restless sexual energies
     …  Monica engineered another change in her son’s life
     …  Of his mistress’s feelings, he gives us no glimpse, noting simply, “She went back to Africa
     …  no bodily pleasure, no matter how great, could ever match the happiness of the saints
     …  Augustine and Monica experienced something remarkable: they felt themselves climbing higher and higher, through all the degrees of matter and through the heavenly spheres and, higher
     …  the thirty-two-year-old son and the fifty-five-year-old mother to reach this climax together
     …  Adam and Eve .. originale peccatum
     …  Holy virginity became pregnant, not by conjugal intercourse, but by faith—lust being utterly absent
     …  Some people can even move their ears, either one at a time or both together.
     …  Along with these doctrinal purposes, Augustine’s obsessive engagement with the story of Adam and Eve spoke to something in his life.
     …  Adam’s fatal choice /17-06-16

    G20 must govern the shift to low-carbon energy
     …  Wind energy and other renewables will replace oil, gas and coal
     …  We must halve oil production and stop using coal to produce electricity.
     …  There will be winners and losers. /17-06-13

    building block of life found in very young star system
     …  methyl isocyanate
     …  planet-forming cloud
     …  the level of complexity you can get to before planets form is pretty high /17-06-08

    human faces
     …  Researchers at CalTech were able to predict the appearance of faces shown to macaque monkeys simply by monitoring signals in their brains. Credit
     …  The brain has an amazing capacity for recognizing faces.
     …  they have deciphered the code of how faces are recognized.
     …  electrical recordings from face cells .. neurons that respond .. when an image of a face is presented to the retina
     …  photos of some 2,000 human faces
     …  The monkey face recognition system seems to be very similar to that of humans.
     …  Just 200 face cells are required to identify a face
     …  These dimensions create a mental “face space”
     …  Though the networks are successful, they are also a black box because it is hard to reconstruct how they achieve their result.
     …  the brain is similarly a black box /17-06-06

    the Heart of AI
     …  No one really knows how the most advanced algorithms do what they do. That could be a problem.
     …  it was unlike anything demonstrated by Google, Tesla, or General Motors, and it showed the rising power of artificial intelligence. The car didn’t follow a single instruction provided by an engineer or programmer. Instead, it relied entirely on an algorithm that had taught itself to drive by watching a human do it.
     …  The system is so complicated that even the engineers who designed it may struggle to isolate the reason for any single action.
     …  deep learning
     …  to diagnose deadly diseases, make million-dollar trading decisions, and do countless other things to transform whole industries.
     …  Starting in the summer of 2018, the European Union may require that companies be able to give users an explanation for decisions that automated systems reach.
     …  to serve ads or recommend songs. The computers that run those services have programmed themselves, and they have done it in ways we cannot understand.
     …  we humans can’t always truly explain our thought processes either
     …  Deep Patient, was trained using data from about 700,000 individuals, and when tested on new records, it proved incredibly good at predicting disease.
     …  the machine essentially programs itself.
     …  deep learning is a particularly dark black box.
     …  It might be part of the nature of intelligence that only part of it is exposed to rational explanation.
     …  certain images could fool such a network into perceiving things that aren’t there
     …  Even if somebody can give you a reasonable-sounding explanation [for his or her actions], it probably is incomplete, and the same could very well be true for AI
     …  a natural part of the evolution of intelligence itself is the creation of systems capable of performing tasks their creators do not know how to do. /17-06-05

    Noam Chomsky
     …  ?So there’s the two existential threats that we’ve created—which might in the case of nuclear war maybe wipe us out; in the case of environmental catastrophe, create a severe impact—and then some.
     …  ?A third thing happened. .. ?It’s called neoliberalism.
     …  Starting in the early ’70s there was a sharp change. First of all, financial institutions exploded in scale.
     …  unelected troika: the European Commission, which is unelected; the IMF, of course unelected; and the European Central Bank.
     …  ?it’s not just inequality, stagnation. It’s terminal disaster. /17-06-05

    CZESLAW MILOSZ’S BATTLE FOR TRUTH
     …  both Nazi and Communist rule, Poland’s great exile poet arrived at a unique blend of skepticism and sincerity
     …  Andrzej Franaszek’s “Milosz: A Biography” (Harvard)
     …  As an aristocrat without money, and a Pole whose homeland was Lithuania
     …  repelled by the Poles’ religiosity and nationalism
     …  The creative act is associated with a feeling of freedom
     …  The belief in reason .. is unreasonable
     …  poetry must not darken the world but illuminate it
     …  moral authority /17-05-25

    Elbphilharmonie in Hamburg’s port, resembles an avant-garde ocean liner
     …  Elphi
     …  Concert-hall design has entered its grand mannerist phase, or, some might argue, its age of decadence
     …  Philharmonie de Paris
     …  The first billion-dollar hall is not far of
     …  German .. more than eighteen million people attended classical concerts in the 2015-16 season .. considerably higher than the number of people who had gone to see soccer games
     …  “vineyard” plan: as at the Paris Philharmonie, the Berlin Philharmonie, and Disney Hall, in Los Angeles, the performers occupy the center
     …  Yasuhisa Toyota, who has engineered a string of triumphs, including Disney. His signature achievement has been to add resonant warmth to the clinical clarity
     …  though, something is off /17-05-23

    WannaCry
     …  It has been neglected for too long
     …  first in Britain and Spain, and then around the world. It would reach 230,000 computers in 48 hours
     …  This is not a serious organised crime gang
     …  it reuses software stolen several months ago from America’s National Security Agency (NSA) /17-05-23

    transhumanism .. the meat-free option
     …  liberate the mind from its sub-optimal hardware
     …  Google high-up Ray Kurzweil
     …  We will be able to live as long as we want
     …  By the end of this century, the nonbiological portion of our intelligence will be trillions of times more powerful
     …  The Next Human: Taking Evolution into Our Own Hands
     …  Ghost in the Cloud: Transhumanism’s simulation theology
     …  machines more intelligent than we are will usurp our role as captains of our destinies
     …  human ingenuity, .. can in fact overcome our inbuilt flaws
     …  a failure to appreciate the richness and fullness of lived life
     …  idea of gathering data on a person’s life – photographs, biographical detail, social media activity – with which to reconstruct their personality /17-05-18

    John Cage
    I have nothing to say
    and I am saying it
    and that is poetry
    as I need it.          /17-05-17

    “mystery” of Stradivari
     …  Listener evaluations of new and Old Italian violins
     …  under blind conditions, experienced violinists tend to prefer playing new violins over Old Italians
     …  they are unable to tell new from old
     …  from the perspective of listeners in a hall
     …  Results are unambiguous. The new violins projected better /17-05-09

    Artificial intelligence will have implications for policymakers in education, welfare and geopolitics
     …  technological progress, and artificial intelligence in particular, will require big changes in the way education is delivered
     …  “nanodegrees” which can be completed in a few months
     …  Automation could have a much bigger impact in developing economies than in rich ones
     …  Finland and the Netherlands, are planning to experiment with limited forms of basic income next year /17-05-08

    Consciousness Is Made of Atoms
     …  Sensations are the building blocks of consciousness.
     …  neural systems evolved to enable animals to move in their environments
     …  stimuli exist in analog form and are converted into digital form by the receptor cells and the neural circuits
     …  a small portion of an undifferentiated stream of stimuli is selected by the organism and given a specific identity.
     …  There is nothing “mental” or “physical” in this account of sensations. That distinction makes sense only much further down the line in the evolution of neural systems and requires the development of memory and neural plasticity /17-04-28

    Quantum Theory
     …  does the quantum state ultimately represent some objective aspect of reality, or is it a way of characterizing something about us, namely, something about what some person knows about reality?
     …  do these results rule out the idea that the quantum state is a feature of our mind? Well, yes and no.
     …  fundamental assumptions. One is that the world is always in some ontic state, a determinate physical state independent of what we happen to know
     …  Saying a problem is “philosophical” makes it seem as if it falls outside the scope of mathematical and experimental physics.
     …  And that is unambiguous progress—both scientific and philosophical. /17-04-28

    a better death
     …  Death is inevitable. A bad death is not
     …  Cancer patients who die in hospital typically experience more pain, stress and depression than similar patients who die in a hospice or at home.
     …  few, when asked about their hopes for their final days, say that their priority is to live as long as possible. Rather, they want to die free from pain
     …  doctors do “everything possible”, as they have been trained to
     …  legalisation of doctor-assisted dying, so that mentally fit, terminally ill patients can be helped to end their lives if that is their wish. /17-04-28

    never .. to write a grant application again
     …  Self-organized fund allocation (SOFA)
     …  they all receive an equal share of the funding budget annually—some €30,000 in the Netherlands, and $100,000 in the United States—but they have to donate a fixed percentage to other scientists whose work they respect and find important
     …  wisdom of the crowd
     …  If scientists allocated 50% of their money to colleagues they cite in their papers, research funds would roughly be distributed the way funding agencies currently do .. but at much lower overhead costs
     …  Scheffer and Bollen /17-04-28

    Octopuses .. Genes
     …  incredibly intelligent
     …  RNA editing that’s very rare
     …  fine-tune the information encoded by their genes
     …  RNA editing is still mysterious, and its purpose unclear.
     …  but their genomes are rigid and stagnant.
     …  By changing their RNA rather than their DNA, they might be more effective at adapting to challenges on the fly.
     …  the creatures could turn them on or off depending on the circumstance.
     …  encode experiences in this way. /17-04-26

    Elon Musk ... Neuralink wants to redefine what future humans will be
     …  600 million years ago, no one really did anything, ever .. no one had any nerves
     …  The jellyfish was the first animal to figure out that nerves were an obvious thing .. in order to increase the odds of life going well, rather than just floating aimlessly
     …  The flatworm ... a nervous system boss .. first central nervous system .. brain
     …  mammals .. were in touch with complex feelings like love, anger, and fear .. first limbic system
     …  tool-making, hunting strategy, and cooperation with other .. neocortex
     …  the first animal that could think complex thoughts .. symbol .. language
     …  50,000 BC, humans were speaking
     …  Language allows the best epiphanies of the very smartest people, through the generations, to accumulate into a little collective tower of tribal knowledge
     …  Mass cooperation raised the quality of life for everyone, and by 10,000 BC, the first cities had formed.
     …  started writing things down about 5 – 6,000 years ago
     …  Gutenberg .. probably actually invented in China
     …  Machines were better than humans
     …  The first digital computers sprung up in the 1940s.
     …  The internet gave billions of humans instant, free, easily-searchable access to the entire human knowledge
     …  Computers have been a game-changer
     …  computers still can’t quite do. Thinking.
     …  brain-machine interface
     …  catch-22: “If the human brain were so simple that we could understand it, we would be so simple that we couldn’t.” /17-04-26

    First evidence for higher state of consciousness found
     …  University of Sussex
     …  increase in neural signal diversity .. under the influence of psychedelic drugs
     …  how conscious level (how conscious one is) and conscious content (what one is conscious of) are related to each other /17-04-19

    Is Matter Conscious?
     …  the central problem in neuroscience is mirrored in physics
     …  Our first-person experience, on the other hand, lies beyond the traditional methods of science.
     …  David Chalmers
     …  What is physical matter in and of itself
     …  our consciousness is rooted in the physics and chemistry of the brain
     …  How and why does a system that integrates information, broadcasts a message, or oscillates at 40 hertz feel pain or delight?
     …  there is reason to believe that there must be more to matter than what physics tells us
     …  particles .. how they are in themselves
     …  The hard problem of matter calls for non-structural properties, and consciousness is the one phenomenon we know that might meet this need.
     …  dual-aspect monism
     …  what it is like to be that system
     …  panpsychism
     …  consciousness is the real concrete stuff of reality, the fundamental hardware /17-04-19

    The United States launched a missile strike in Syria
     …  Vladimir Putin can’t be pleased
     …  Trump’s basic unpredictability
     …  If Putin’s dream is to sit down with Trump and draw lines on a map of the world, dividing up spheres of influence, how can he do that with such an unreliable counterpart?
     …  for the first time, Assad is paying a price
     …  proportional response /17-04-08

    Daniel Dennett’s naturalistic account of consciousness
    Four billion years ago, Earth was a lifeless place. Nothing struggled, thought, or wanted. Slowly, that changed. Seawater leached chemicals from rocks; near thermal vents, those chemicals jostled and combined. Some hit upon the trick of making copies of themselves that, in turn, made more copies. The replicating chains were caught in oily bubbles, which protected them and made replication easier; eventually, they began to venture out into the open sea. A new level of order had been achieved on Earth. Life had begun.
    The tree of life grew, its branches stretching toward complexity. Organisms developed systems, subsystems, and sub-subsystems, layered in ever-deepening regression. They used these systems to anticipate their future and to change it. When they looked within, some found that they had selves—constellations of memories, ideas, and purposes that emerged from the systems inside. They experienced being alive and had thoughts about that experience. They developed language and used it to know themselves; they began to ask how they had been made.
     …  His newest book, “From Bacteria to Bach and Back,” tells us, “There is a winding path leading through a jungle of science and philosophy, from the initial bland assumption that we people are physical objects, obeying the laws of physics, to an understanding of our conscious minds.”
     …  “Consciousness Explained,” a 1991
     …  science can explain consciousness in purely material terms
     …  the zombie problem as a typically philosophical waste of time
     …  like evolution, essentially gradualist, without hard borders /17-03-23

    Anna O. Szust .. fake editor
     …  dozens of academic titles offered 'Dr Fraud' — a sham, unqualified scientist — a place on their editorial board
     …  Thousands of academic journals do not aspire to quality. They exist primarily to extract fees
     …  parasitic publishers
     …  in 2015, we created a profile of a fictitious scientist named Anna O. Szust and applied on her behalf to the editorial boards of 360 journals
     …  accounts for Szust on Academia.edu, Google+ and Twitter, and made a faculty webpage at the Institute of Philosophy at the Adam Mickiewicz University in Poznań
     …  One publisher suggested that the profits be split (“60% us 40% You”)
     …  predatory journals on Beall's list (about 10,000)
     …  We have not included journal titles in this article, in part because predatory publishers often choose names confusingly similar to reputable titles
     …  Piotr Sorokowski, Emanuel Kulczycki, Agnieszka Sorokowska, Katarzyna Pisanski /Nature/17-03-23

    Atheism is as natural as religion
     …  the ancient world did not believe in Gods, contrary to popular belief
     …  religious universalism
     …  the paradoxical nature of religion – the fact that it asks you to accept things that aren’t intuitively there in your world
     …  when the generally tolerant societies were replaced by imperial forces that demanded the acceptance of one true God
    UK was sixth from bottom, vastly less religious than Thailand (94% religious) and Armenia, Bangladesh, Georgia and Morocco (93%)
     …  The least religious country was found to be China, where only 6% of people say are they are religious with 61% being confirmed atheists. Other countries at the bottom of the list included Japan, Sweden, Czech Republic, Netherlands and Hong Kong. /17-03-15

    Quantum technologies
     …  supersensitivity makes it great for measuring
     …  atomic clock could use this discrepancy to make an ultra-precise height measurement
     …  quantum gravimeters
     …  nanoscale diamonds with nitrogen vacancies
     …  ghost imaging
     …  magnetometers that can in principle watch your every neuron
     …  ufficiently long cipher, randomly generated this way and used only once, is absolutely secure
     …  quantum computers so attractive .. they will work fundamentally differently
     …  the entangling of multiple qubits is paramount
     …  a description of a 50-qubit computer would require a quadrillion bits of digital memory
     …  anyons
     …  Shor’s famed algorithm .. a million qubits
     …  Feynman .. the computer will do exactly the same as nature
     …  David Deutsch .. quantum computer would serve as proof positive of universes beyond the known: the “many-worlds interpretation”
     …  constructor theory asserts that those laws actually arise from what is and is not possible
     …  software .. Windows for quantum
     …  Even deeper learning
     …  Quantum Algorithm Zoo /17-03-14

    DNA could store all
     …  More data were created in the past 2 years than in all of preceding history.
     …  215 million gigabytes in a single gram of DNA
     …  72,000 DNA strands, each 200 bases long
     …  1.6 bits of data per nucleotide
     …  writing and reading to DNA is relatively slow /17-03-03

    Giant Neuron
     …  a giant neuron wrapped around the entire circumference of a mouse's brain
     …  across both hemispheres
     …  it could be coordinating signals from different areas to create conscious thought
     …  The claustrum is so densely connected /17-03-02

    the limitations of reason
     …  Once formed, impressions are remarkably perseverant
     …  The Enigma of Reason
     …  Coöperation is difficult to establish and almost as difficult to sustain. For any individual, freeloading is always the best
     …  Reason is an adaptation to the hypersocial niche
     …  “myside bias”
     …  the environment changed too quickly for natural selection to catch up
     …  The Knowledge Illusion: Why We Never Think Alone
     …  “illusion of explanatory depth”
     …  no sharp boundary between one person’s ideas and knowledge and those of other member of the group
     …  ways of thinking that now seem self-destructive must at some point have been adaptive
     …  people experience genuine pleasure—a rush of dopamine—when processing information that supports their beliefs
     …  Providing people with accurate information doesn’t seem to help /17-03-01

    taxing robots is not a good idea
     …  Bill Gates’s proposal
     …  scepticism about society’s ability to manage rapid automation
     …  negative externality
     …  Automation can be understood as the replacement of labour with capital /17-02-24

    eighth continent: Zealandia
     …  New Zealand and New Caledonia, is a single, intact piece of continental crust and is geologically separate from Australia /17-02-22

    how planets form
     …  Seven alien, Earth-sized worlds bask in the cool, red light of their parent star
     …  39 light years from Earth
     …  You can imagine how many nearby stars might harbour lots and lots of planets
     …  orbit their star roughly every 4, 6, 9 and 12 days /17-02-22

    Gene editing, clones and the science of making babies
     …  haemophilia and sickle-cell anaemia can be fixed before an embryo even starts to develop
     …  cloning humans steadily more feasible
     …  playing God
     …  whether “test-tube” babies would have souls
     …  Growing sperm and eggs from body cells
     …  gay couples could have children related to both parents
     …  protect the interests of the unborn
     …  opinions change as people get used to new techniques /17-02-20

    Homo Deus Foresees a Godlike Future, Harari
     …  the free individual is just a fictional tale
     …  more people die today from eating too much than from eating too little
     …  humans are in fact trying to upgrade themselves into gods
     …  select embryos with the best odds
     …  to slow the aging process
     …  our radical transformation
     …  Relatively small changes in genes, hormones and neurons .. were enough to transform Homo erectus — who could produce nothing more impressive than flint knives — into Homo sapiens, who produce spaceships and computers
     …  proprietary algorithms to re-engineer brains, bodies and minds
     …  Once artificial intelligence surpasses human intelligence
     …  #Resist /17-02-20

    A computer to rival the brain
     …  In the brain, by contrast, data run simultaneously through billions of parallel processors
     …  without the need for a C.P.U.
     …  to emulate some of the brain’s messiness
     …  including a random-number generator with each neuron
     …  material that changes phase from amorphous to crystalline with a certain degree of randomness
     …  Matter will not execute a computation; it will be the computation.
     …  Our own human algorithms are not necessarily ideal. /17-02-17

    Roger Penrose
     …  is still defining the way we see the universe.
     …  Penrose is irrepressibly eclectic in his learning
     …  quantum mechanics might explain consciousness
     …  Fashion, Faith and Fantasy—but that a book so wide and deep in its erudition could be written at all
     …  surrealist artist Roland Penrose
     …  phenomenal visual sense of geometry
     …  Escher
     …  he attacks is the attempt to unite relativity and quantum mechanics in string theory
     …  a universe with so many dimensions is hard to keep under control
     …  absurdly, was never rewarded with a Nobel Prize
     …  Penrose’s h-index is still nothing special today
     …  in the standoff between quantum mechanics and general relativity, Penrose thinks that the former will crack first
     …  microtubules .. the collapse of these superpositions could enable the brain to solve problems that are formally “non-computable” /17-02-16

    From Bacteria to Bach and Back
     …  Daniel C Dennett
     …  There is no ‘hard problem’ and consciousness is no more mysterious than gravity
     …  Charles Darwin and Richard Dawkins .. Alan Turing and Claude Shannon
     …  memes, that seductive Dawkinsian concept
     …  Granted the right chemical and physical conditions, life forms will emerge from the primeval slime, and granted the right conditions, life will evolve large-brained organisms such as humans – who are profoundly social animals
     …  to think, remember, plan, empathise – in a word, to have a mind
     …  by Natural Selection
     …  qualia .. “the hard problem” – is a false distinction
     …  Chomsky concludes, improbably, that human language must have emerged in our hominid ancestors through one single giant mutational leap, making it possible to find the words to express private thoughts. It is far more probable, Dennett argues, that the origins of language lie in the social nature of humans
     …  It may die, returning the planet to the bacteria /17-02-15

    Physicists are closing the door on ... “spooky action at a distance”
     …  particles have no definite states
     …  until they are measured, when they seem to suddenly roll the dice and jump
     …  both particles together
     …  John Bell
     …  locality, realism and freedom
     …  “freedom-of-choice” loophole
     …  random-number generators to set the devices’ angles of orientation
     …  nature might restrict freedom while maintaining local realism
     …  connections between information and the geometry of space-time
     …  the stronger the gravity in a volume of space-time, the fewer bits can be stored
     …  how to distinguish between a universe that lacks local realism and one that curbs freedom
     …  bright and conveniently located (but otherwise random) star
     …  used the color of an incoming photon from each star to set the angle
     …  to use light from increasingly distant quasars
     …  Superdeterminism
     …  If the correlations are indeed set [at the Big Bang], everything is preordained /17-02-08

    Quantum Foundations ... Steven Weinberg
     …  Decoherence is the process that destroys quantum-ness. It happens constantly and everywhere.
     …  how come on large scales our world is distinctly un-quantum?
     …  “collapse” of the wave-function
     …  depends on your favorite interpretation of quantum mechanics
     …  to use atomic clocks to look for evidence of fundamental decoherence
     …  whether quantum mechanics – in whatever interpretation – is fundamental, or whether there is an underlying theory /17-02-06

    augmented reality
     …  to move the computer from the pocket to the body itself
     …  smart glasses
     …  even more intimate way to interact with machines
     …  it would turn reality itself into a gigantic computer screen
     …  instructions to employees while leaving their hands free
     …  HoloLens
     …  architectural practices (where several designers can work together on a digital representation of a building)
     …  “Glassholes” became social pariahs
     …  Snapchat generation may not be troubled by the idea of being perpetually on camera /17-02-03

    this apparent complexity is all a consequence of thermodynamics
     …  the difference between physics and biology
     …  biology’s only general guiding principle: evolution
     …  nonequilibrium physics, complex systems science
     …  Just how special (or not) is biology?
     …  at the heart of fundamental physics itself: information
     …  information that helps the organism stay out of equilibrium
     …  to extract work from fluctuations in its surroundings
     …  life can be considered as a computation that aims to optimize the storage and use of meaningful information
     …  thermodynamic efficiency of the total computation done by a cell is that it is only 10 or so times more than the Landauer limit
     …  evolution by natural selection is itself just a particular case of a more general imperative
     …  Darwinian logic breaks down” — so long as the system in question is complex, versatile and sensitive enough to respond to fluctuations in its environment
     …  A thermodynamically optimal machine must balance memory against prediction by minimizing its nostalgia — the useless information about the past
     …  “causal entropic force”
     …  the thermodynamics of nonequilibrium systems makes the emergence of organized, complex systems much more likely on a prebiotic Earth far from equilibrium
     …  meaning and intention — may emerge as a natural consequence of statistics /17-02-02

    looking for deviations from Newton’s inverse-square law of gravity
     …  why gravity is so much weaker than the other
     …  gravitational interactions of objects less than 100 microns apart
     …  to a test of string theory /17-01-30

    An Organized Collection of Irrational Nonsencse /17-01-30

    Poker Is a Big Deal for Artificial Intelligence
     …  poker involves dealing with imperfect information, which makes the game very complex, and more like many real-world situations
     …  Libratus is up by almost $800,000 against its human opponents.
     …  It is fundamentally different from checkers, chess, or Go, because an opponent’s hand remains hidden
     …  There is no single optimal move, but instead an AI player has to randomize its actions so as to make opponents uncertain
     …  game theory, or the mathematics of strategic decision making
     …  involves some form of approximation
     …  how to randomize your play in a way that is, in a sense, optimal.
     …  a new equilibrium approximation technique
     …  end-game analysis is computationally very challenging, and is performed during each game at the Pittsburgh Supercomputing Center
     …  Charles University and Czech Technical University /17-01-30

    methods of neuroscience are left wanting
     …  bottomless appetite for data
     …  published in PLOS Computational Biology
     …  neuroscience’s favourite analogy: comparing the brain to a computer
     …  who both have backgrounds in neuroscience and electronic engineering
     …  Caenorhabditis elegans, which has just 302 nerve cells
     …  understand much less about how the creature’s “brain” works than they do about computer chips with millions of times as many components.
     …  Obtaining data is one thing. Working out what they are saying is another. /17-01-23

    Origin of Complex Life
     …  newly discovered microbes .. Asgard
     …  two billion years ago
     …  For the longest time, living things belonged to two great domains: the bacteria and the archaea
     …  Bacteria and archaea are capable of amazing feats of evolution, but in over 3.7 billion years of existence, none of them have ever evolved into anything approaching a eukaryote-like cell—except that one time. Why?
     …  a bacterium found its way inside an archaeon and, rather than being digested or destroyed, became a permanent part of its host. /17-01-19

    Zygmunt Bauman (1925 - 2017) /17-01-17

    Percepcja zmienia się w forum dyskusyjne, którego zwyciezcę nazywamy "sobą".
    /Maria Anna Potocka, Nowa estetyka, Poznanie rozszerzone, str. 206/17-01-13

    education fails to keep pace with technology, the result is inequality
     …  reformers in the Industrial Revolution, heralding state-funded universal schooling
     …  robotics and artificial intelligence call for another education revolution
     …  working lives are so lengthy and so fast-changing
     …  If 21st-century economies are not to create a massive underclass
     …  on-the-job training is shrinking
     …  Self-employment is spreading, leaving more people to take responsibility for their own skills.
     …  Massive open online courses (MOOCs) have veered away from lectures on Plato or black holes in favour of courses that make their students more employable.
     …  “microcredentials” and “nanodegrees” in, say, self-driving cars or the Android operating system
     …  to teach children how to study and think
     …  A focus on “metacognition” /17-01-13

    Sotheby’s Solid $295 Million Contemporary Sale
     …  a correction to an overheated market
     …  Cy Twombly, Untitled (New York City), (1968)
     …  postwar and contemporary art
     …  $45-million Mark Rothko
     …  Covered with his trademark looping white scribbles on a slate-gray background, the work recalls his experience as a cryptologist at the Pentagon.
     …  Andy Warhol’s canvas Mao (1972)
     …  Jackson Pollock, Lucio Fontana, Francis Bacon, and Jean-Michel Basquiat.
     …  really good prices for really good things /17-01-13

    choice of a life partner is no accident
     …  to marry someone a lot like you. Similar intelligence, similar height, similar body weight.
     …  these preferences are shaping our genomes
     …  a strong statistical correlation between people’s genetic markers for height and the actual height of their partner.
     …  People had actively chosen partners with similar genes to themselves
     …  whether those choices, too, are rooted in DNA. /17-01-12

    exotic looped trajectories of light in three-slit experiment
     …  even when only one of the three slits is illuminated /17-01-12

    Deep-Learning Machine Listens to Bach, Then Writes Its Own Music in the Same Style
     …  Can you tell the difference between music composed by Bach and by a neural network?
     …  chorale cantata
     …  delicate interplay between harmony and melody
     …  about half the time, these compositions fool human experts into thinking they were actually written by Bach
     …  They begin with 352 chorales composed by Bach and then transpose these to other keys that lie within a predefined vocal range, to give a data set of 2,503 chorales. They use 80 percent of these to train their neural network to recognize Bach harmonies and the rest to validate it.
     …  to study the nature of creativity /17-01-11

    Many-moons theory
     …  an identity crisis
     …  single-impact hypothesis
     …  Big Splash
     …  the product not of one impact but of at least a dozen—and it isn’t just one moon but an amalgam of the many moons that came before it
     …  Our current moon is also undoubtedly our last, or at least the last one that we’ll see. Its orbit is slowly expanding, sending it a couple of inches or so farther from Earth every year /17-01-11

    Coming From a Galaxy Far, Far Away
     …  extremely powerful radio blast
     …  three billion light-years away
     …  he early universe
     …  what—or perhaps who—is producing them
     …  global network of powerful telescopes
     …  magnetars
     …  death shrieks of stars collapsing into black holes
     …  being broadcast by aliens
     …  We’re actively monitoring only a tiny, tiny fraction of the sky at any given time.
     …  FRB 121102, was repeatedly broadcasting signals.
     …  some mechanism that is capable of repetition
     …  FRB 121102 wasn’t erupting according to any predictable pattern
     …  Gemini optical telescope
     …  supermassive black hole
     …  The honest answer is that we don't know /17-01-09

    Humans are probably not the greatest intelligences in the universe.
     …  But even on Earth
     …  The world Go, chess, and Jeopardy champions are now all AI.
     …  smarter than humans in every respect
     …  scientific reasoning and social skills
     …  two forms of superhuman intelligence—alien and artificial—may not be so distinct
     …  The transition from biological to synthetic intelligence may be a general pattern
     …  I prefer the term “postbiological” to “artificial”
     …  Our brains evolved for specific environments and are greatly constrained by chemistry and historical contingencies.
     …  much faster than traditional biological evolution
     …  we already see reasons why synthetic intelligence will outperform us
     …  Neurons reach a peak speed of about 200 hertz, compared to gigahertz
     …  machines have almost unlimited room for improvement
     …  Ray Kurzweil takes an optimistic view of the postbiological phase of evolution, suggesting that humanity will merge with machines, reaching a magnificent technotopia. But Stephen Hawking, Bill Gates, Elon Musk
     …  humans could lose control of superintelligent AI
     …  the “control problem”
     …  A clever machine could bypass safeguards
     …  many worry that the control problem is insurmountable
     …  Active SETI
     …  to claim that we can foresee the computational abilities and energy needs of a civilization millions or even billions of years ahead of our own
     …  superintelligent AIs, being self-improving, could quickly morph into an unrecognizable form
     …  perhaps it is in dark matter
     …  we should not rule out the possibility that the chemical differences also impact other key functions, such as whether silicon gives rise to consciousness
     …  whether an information-processing system supports consciousness
     …  Silicon-based brain chips are already under development as a treatment for various memory-related conditions, such as Alzheimer’s
     …  If, at some point, chips are used in areas of the brain responsible for conscious functions, such as attention and working memory, we could begin to understand whether silicon is a substrate for consciousness.
     …  that the only “chip” that works is one that is engineered from biological neurons
     …  consciousness engineering
     …  it may be more efficient for a self-improving superintelligence to eliminate consciousness
     …  Consciousness is correlated with novel learning tasks that require attention and focus. A superintelligence would possess expert-level knowledge in every domain, with rapid-fire computations ranging over vast databases that could include the entire Internet and ultimately encompass an entire galaxy.
     …  the most intelligent systems will not be conscious. On cosmological scales, consciousness may be a blip, a momentary flowering of experience before the universe reverts to mindlessness.
     …  benevolent species will see fit to create their own AI mindchildren /17-01-05

    Mitochondria contain their own DNA
     …  mitochondria were once independent single-celled organisms until, more than a billion years ago
     …  today’s plants and animals
     …  just 37 genes
     …  producing certain mitochondrial proteins right where they’re needed helps the cell better regulate energy production
     …  mitochondria, with their history as stand-alone cells, are the only ones with their own command center /17-01-02

    2016

    można wrażeń dotykać precz z ich rozumieniem /Lot nad miastem, Anna Maria Musz, str. 9 / 16-12-31

    DNA editing
     …  “sculpting evolution” group at M.I.T.
     …  fundamentally altering the natural world
     …  the new gene will copy itself in every successive generation
     …  There has never been a more powerful biological tool
     …  complete transparency
     …  to eradicate malaria
     …  Natural selection is heinously immoral
     …  romantic notions of a natural world defined by innocence and harmony
     …  by editing a gene, transform a common virus into a biological weapon
     …  Ethical choices in medicine are rarely straightforward
     …  crispr, however, privileges design over evolution
     …  A release anywhere could be a release everywhere.
     …  if an edit cannot be corrected it should not be attempted
     …  molecular Noah’s Ark
     …  a daisy drive, separates the components of any gene drive into discrete parts—a genetic version of a multistage rocket
     …  We have engineered the world around us since the beginning of humanity. The real question is not whether we will continue to alter nature for our purposes but how we will do so. /16-12-29

    Steven Pinker
     …  At many moments of 2016, it seemed the world was falling apart.
     …  Or the election of Donald Trump
     …  In August, he told me the world is still in a more peaceful period than at any other time in history.
     …  Look at history and data, not headlines.
     …  the worldwide, decades-long current toward racial tolerance is too strong to be undone by one man
     …  As it happens, most global, long-term trends have been positive. /16-12-25

    images of black holes are illustrations
     …  what our telescopes actually capture
     …  because of their strong gravity, black holes tend to be surrounded by other bright matter that makes it hard to see the object itself
     …  indirect images of black holes
     …  Milky Way galaxy is evidence of a black hole there
     …  What they’re hoping to see is the actual shadow, the actual dark region /16-12-25

    Quantum Gravity
     …  ‘echoes’ of gravitational waves coming from blackhole mergers might be signs of a theory that finally unifies quantum mechanics and general relativity.
     …  the Planck scale: the smallest region of space, the shortest span of time
     …  ‘atoms’ of space
     …  For GR, space is smooth
     …  LIGO
     …  signs (in the data) of a quantum-gravity effect known simply as an echo
     …  statistical significance of 2.9 sigma /16-12-21

    Time Travel
     …  before the invention of the printing press, .. notions of any sort of temporal dislocation were next to impossible; people saw the future as relatively similar to the past
     …  Industrial Revolution—when people could see just how different the world looked from how it had a decade earlier
     …  memory is anything but precise .. it plays tricks on us
     …  the fallibility of memory isn’t necessarily a quirk or negative side effect of neural wiring but a necessity for being able to imagine the future
     …  thinking about the past is absolutely necessary for imagining the future
     …  constructive episodic simulation hypothesis
     …  Time travel, then, is ultimately—and paradoxically—an exercise in remembering. /16-12-20

    2016 was very, very bad
     …  Zika
     …  terrorist attacks
     …  the election
     …  The world is in poor shape to deal with a Trump Presidency.
     …  The worst year, one said, was sixty-five and a half million years ago, when the Chicxulub asteroid hit.
     …  1914
     …  Spanish flu
     …  72,000 B.C., when a Sumatran volcano erupted
     …  1348, the year the Black Death reached Europe
     …  Holocaust
     …  The Better Angels of Our Nature /16-12-16

    What Martin Luther did to the Catholic church needs to be done to business gurus
     …  500th anniversary
     …  including Roman Catholicism itself
     …  Just as the clergy in the Middle Ages spoke in Latin to give their words an air of authority, management theorists speak in mumbo-jumbo.
     …  The most striking business trend today is not competition but consolidation.
     …  The World is Flat
     …  The World’s Local Bank
     …  In 1880-1914 the world was in many ways just as globalised as it is today /16-12-16

    2040, embryo selection could replace sex
     …  eliminate many genetic diseases, extend healthy lifespans
     …  ethical questions about diversity, equality and what it means to be human
     …  preimplantation genetic screening
     …  many genetic diseases will come to be seen as preventable parental lifestyle choices rather than bad luck
     …  to select the gender of their future children
     …  assisted reproduction technologies when conceiving children
     …  the world population does not bifurcate into genetic haves and have-nots?
     …  Our genetically altered future has already begun. /16-12-14

    How long will it be before you lose your job to a robot?
     …  Deep Blue
     …  Watson
     …  parsing and semantic analysis suite
     …  Google, Microsoft, and Amazon were competing with I.B.M. to dominate the era of intelligent machines
     …  What business will want to hire a messy, complex carbon-based life form when a software tweak can get the job done just as well?
     …  Jobless Future
     …  Employment migrated from farms and mills to factories and offices to cubicles and call centers.
     …  Picture the entire Industrial Revolution compressed into the life span of a beagle.
     …  process reengineering
     …  At present, machines are not very good at walking up stairs, picking up a paper clip from the floor, or reading the emotional cues of a frustrated customer
     …  U.S. textile plants return, with floors largely empty of people.
     …  collective form of semi-retirement
     …  guaranteed basic income
     …  brings us back to Trump
     …  How this will all end, no one can say with confidence, except, perhaps, for Watson. /16-12-15

    Human Population Through Time - video /16-12-14

    Edward Burtynsky, a Canadian photographer
     …  ocumenting colossal mines, quarries, dams, roadways, factories, and trash piles
     …  eight-pound digital Hasselblad
     …  effort to photograph industry has evolved into something of an industrial process itself.
     …  naturalism and modernism pushed up against each other
     …  Burtynsky has never found Cartier-Bresson’s dictum relevant to his method
     …  Camera-mounted drones allow Burtynsky to find precise aerial vantage points.
     …  neo-Expressionist paintings: darkly gorgeous portraits of devastation
     …  it takes two people to use Photoshop: one to work, the other to say when to stop
     …  Beyond making adjustments to color, he said, he would not tamper with an image. His work, in many ways, requires that the image’s authenticity go unquestioned. /16-12-14

    The Core Theory
     …  Nobel laureate Frank Wilczek advocates viewing the standard model of particle physics as consisting of two “kingdoms,” one comprising the basic particles of matter and the other consisting of the particles that transmit nature’s fundamental forces.
     …  core includes gravity
     …  foresees the discovery of proton decay
     …  the laws of physics, rather than emphasizing energy, will someday be rewritten in terms of “information and its transformations”
     …  biological memory, cognitive processing, motivation, and emotion will be understood at the molecular level
     …  Calculation will increasingly replace experimentation in design of useful materials, catalysts, and drugs, leading to much greater efficiency and new opportunities for creativity.
     …  ultradense energy storage
     …  three-dimensional, fault-tolerant, self-repairing computers will be developed
     …  quantum artificial intelligence
     …  expanded identities /16-12-12

    Stephen Hawking This is the most dangerous time for our planet
     …  we have the means to destroy our world but not to escape it
     …  rejection of the elites in both America and Britain
     …  cry of anger by people who felt they had been abandoned
     …  rise of artificial intelligence is likely to extend this job destruction deep
     …  economic inequality
     …  This is inevitable, it is progress, but it is also socially destructive.
     …  Instagram nirvana is not available there
     …  climate change
     …  we need to break down, not build up, barriers within and between nations.
     …  I am an enormous optimist for my species; but /The Guardian/16-12-03

    energy storage technologies
     …  High-Performance One-Body Core/Shell Nanowire Supercapacitor Enabled by Conformal Growth of Capacitive 2D WS2 Layers
     …  capacitive materials for supercapacitor devices owing to their intrinsically layered structure and large surface areas
     …  an exceptional charge–discharge retention over 30,000 cycles owing to their structural robustness /16-11-24

    Sean Carroll, The Big Picture: On the Origins of Life, Meaning, and the Universe Itself

    Our goal is to offer plausibility sketch that the world can ultimately be understood on the basis of naturalism. We don't know how life began, or how consciousness works, but we can argue that there's little or no reason to look beyond the natural world for the right explanations. We can always be wrong in that belief; but then again, we can always be wrong about any belief.


     …  science is precluded from making statements about supernatural forces because these are outside its provenance. Not really. Science should be interested in determining the truth, whatever that truth may be- natural, supernatural or otherwise.

     … 
    Is it possible that God exists, and communicates with human beings in ways that circumvent our ordinary senses? Absolutely. As Plantinga correctly points out, if theism is true,
     … 

     … 

     … two competing propositions: one is that God Exists,
     …  the other is naturalism, which would explain such experiences the same way it would explain dreams or hallucinations or other impressions
     …  To decide between them, we need to see which one coheres better with other things we believe about the world.

     … 
    Given the profound and deeply personal nature of prayer, meditation, and contemplation, it can seem frivolous or diminishing to relate them to psychedelics or the activity of neurons, or even to dispassionate scientific investigation of any sort. But if we wont to undertake our journey to the best possible understanding of the world with the intellectual honesty it deserves, we always have to question our beliefs, consider alternatives, and compare them with the best evidence we can gather. It may be the case that transcendent experiences arise from a direct connection with a higher level of reality, but the only way to know is to weight that idea against what we learn from the world by looking at it.

     … 


    /16-11-20

    Quantum Brain
     …  fragile quantum states may be able to exist for hours or even days in our warm, wet brain
     …  quantum consciousness
     …  quantum effects might indeed play some role in human cognition
     …  nuclear spins of phosphorus atoms
     …  the brain to function like a quantum computer
     …  Roger Penrose .. “microtubules”
     …  migratory birds have a “quantum compass”
     …  human sense of smell could be rooted in quantum mechanics
     …  quantum neuroscience
     …  Would a different isotope, like the much more rare lithium-6, produce the same results?
     …  lithium-6 can remain entangled longer
     …  entanglement must then have some chemically feasible means of influencing how neurons fire in some way.
     …  transporting quantum information stored in the qubits throughout the brain.
     …  Posner molecules
     …  The evidence is building up that we can explain everything interesting about the mind in terms of interactions of neurons /16-11-14

    depression
     …  A new generation of drugs
     …  Prozac .. chemical imbalance in the brain, which the drug corrects. Unfortunately, this idea seems to be only part of the story.
     …  esketamine
     …  Lots of drugs, for many indications, work well, even though no one knows precisely how.
     …  ketamine has opened up a new line of attack /16-11-14

    With Trump, coal wins, planet loses
     …  climate change a “hoax”
     …  he made clear what his plans were in the areas of energy and the environment
     …  More than you might think
     …  fate of the planet will be decided by global economic forces more than by any particular treaty or set of regulations.
     …  The liberal-left just lost the ‘battle’ against climate change.
     …  And, in hundreds and hundreds of years, the impacts of the fossil fuels that we’re now burning will still be playing out. /16-11-11

    Donald Trump to the Presidency is nothing less than a tragedy for the American republic, a tragedy for the Constitution, and a triumph for the forces, at home and abroad, of nativism, authoritarianism, misogyny, and racism.
     …  we will bid farewell to the first African-American President—a man of integrity, dignity, and generous spirit
     …  People can behave foolishly, recklessly, self-destructively in the aggregate just as they can individually.
     …  Fascism is not our future—it cannot be; we cannot allow it to be so—but this is surely the way fascism can begin.
     …  Why not leave the country? But despair is no answer. To combat authoritarianism, to call out lies, to struggle honorably and fiercely in the name of American ideals—that is what is left to do. That is all there is to do. /The New Yorker/16-11-09

    It looks like scientists and philosophers might have made consciousness far more mysterious than it needs to be
     …  conscious experience is seen as deeply grounded in how brains and bodies work together
     …  David Chalmers’s ..‘hard problem’
     …  mapping their phenomenological properties (subjective first-person descriptions of what conscious experiences are like) onto underlying biological mechanisms (objective third-person descriptions)
     …  brain is almost as active during dreamless sleep as it is during conscious wakefulness
     …  consciousness seems to depend on how different parts of the brain speak to each other
     …  But during conscious states, a typical echo ranges widely over the cortical surface, disappearing and reappearing in complex patterns. Excitingly, we can now quantify the complexity of these echoes by working out how compressible they are
     …  Complexity measures of consciousness
     …  To measure is to know.
     …  what brains do, not just where they do it
     …  the differences between what the brain expects and what it receives
     …  perception is a controlled hallucination
     …  which aspects of predictive perception go along with consciousness?
     …  people consciously see what they expect, rather than what violates their expectations
     …  ‘alpha rhythm’ .. 10 Hz .. whose function so far has remained elusive
     …  experience of being you
     …  selfhood is also best understood as a complex construction generated by the brain
     …  introspection can be a poor guide
     …  Instead of ‘I think therefore I am’ we can say: ‘I predict (myself) therefore I am.’ The specific experience of being you (or me) is nothing more than the brain’s best guess of the causes of self-related sensory signals.
     …  We are conscious selves because we too are beast machines – self-sustaining flesh-bags that care about their own persistence. /16-11-07

    Świadomość własnej egzystencji, a zwłaszcza jej przemijalności, zmusiła ludzkość do permanentnego poszukiwania radosnych sensów i tym samym do tłumienia bezsensowności przypadku, na jaki jesteśmy skazani. Zmagania prawdziwego bezsensu z wymyślonym sensem to – obok walki o przeżycie – główne zajęcie człowieka. Wydaje się prawdopodobne, że jesteśmy ofiarą „błędu” ewolucyjnego, który polega na preferowaniu wrażliwości i świadomości
     …  w sposób przekraczający potrzeby przeżycia. /Maria Anna Potocka, Nowa estetyka, przypis 6 str. 57/16-11-07

    The idea that humans are ephemeral
     …  compared to the workings of nature isn’t as persuasive as it once was.
     …  Holocene
     …  Anthropocene
     …  radically and permanently disrupted by human activity
     …  The development of agriculture 10,000 years ago, and the Industrial Revolution in the middle of the 19th century
     …  Great Acceleration—the sudden and dramatic jump in consumption that began around 1950
     …  huge rise in global population, an explosion in the use of plastics, and the collapse of agricultural diversity
     …  This dizzying Copernican shift threw both God and man into question.
     …  A single mine in Canada’s tar sands region moves 30 billion tons of sediment annually, double the quantity moved by all the worlds’ rivers combined.
     …  everyone born after 1963 has radioactive matter in their teeth
     …  60 billion chickens are killed for human consumption each year
     …  Single-use plastic
     …  Humans created 5 billion gigabytes of digital information in 2003; in 2013 it took only 10 minutes to produce the same amount of data.
     …  we have decisively shifted the balance /16-11-05

    Solidarity: A word in search of flesh
     …  Who will outsmart who, and who will be kicked out first? This is the job market, and probably society at large, reduced to the level of a TV reality show, writes Bauman. /Zygmunt Bauman/Eurozine/16-11-05

    new anthropomorphism
     …  animals as instinct-driven and incapable of thought
     …  the shared biology of human and animal consciousness
     …  Are We Smart Enough to Know How Smart Animals Are?
     …  from obviously intelligent species, like chimpanzees and elephants, into less-understood animals
     …  rats have also been found to possess empathy, a capacity sometimes said to define humanity
     …  Joseph LeDoux
     …  people shouldn’t hasten to understand them in terms of our own
     …  dolphins, elephants, orangutans, magpies and most recently manta rays, are able to recognize themselves in a mirror
     … 
     …  We still use ourselves as a measuring stick
     …  but fish?
     …  seemingly expressionless faces
     …  insects possess evolutionarily ancient brain structures
     …  If those deer mothers can respond to a human baby’s cry, might they be imagining how that baby feels?
     …  mental state attribution refers to the tendency of animals to project thoughts and feelings onto other animals
     …  It seems to have been an evolutionarily favored way of making sense of the living world.
     …  Turtles may turtle-pomorphize, frogs frog-pomorphize /16-10-26

    algorithms .. aliens
     …  could humans ever understand minds that are radically unlike our own?
     …  human minds, in all their variety, are not the only sorts of minds
     …  chimpanzees, crows
     …  life-forms that have evolved elsewhere in the Universe
     …  artificial intelligence
     …  intelligence ‘measures an agent’s general ability to achieve goals in a wide range of environments
     …  conscious exotica
     …  the possibility of forms of consciousness so alien that we would not recognise them
     …  following Ludwig Wittgenstein, to reject the dualistic idea that there is an impenetrable realm of subjective experience that forms a distinct portion of reality
     …  nothing is hidden
     …  what it is like to be a bat
     …  This supports the dualist’s claim
     …  I am a human, not a bat
     …  biocentrism
     …  to flirt once more with the dualistic thought that there is a hidden order of subjective facts
     …  whether it is like anything at all to be an X
     …  the extent to which a system is, in a specific information-theoretic sense, more than the sum of its parts
     …  David Chalmers, to a metaphysically weighty division between inner and outer – in short, to a form of dualism
     …  vegetative-state patients using an fMRI
     …  Ava .. Garland Test
     …  the study of a mechanism can only complement observation and interaction, not substitute for it
     …  Indeed, no machine, no robot or computer program yet exists that could plausibly be ascribed any capacity for consciousness at all.
     …  Roomba is a fully autonomous robot
     …  Mistake was on move 79, but #AlphaGo only came to that realisation on around move 87
     …  Its ability to respond effectively to subtle board patterns replicates what is often called intuition in top human players.
     …  creativity
     …  human-level artificial general intelligence (AGI)
     …  whole brain emulation
     …  mind children .. Moravec
     …  AlphaGo is capable of taking both its programmers and its opponents by surprise
     …  philosophical impasse
     …  Solaris (1961) by Stanislaw Lem
     …  Some facet of reality might be empirically inaccessible to us, but nothing is hidden as a matter of metaphysics.
     …  our language and practices could change in unforeseeable ways to accommodate encounters with exotic forms of intelligence.
     …  Monolithic concepts such as consciousness might break apart
     …  We might well create autonomous, human-level artificial intelligence in the next few decades.
     …  the most profound philosophical projects we can undertake. It is also a neglected one. /16-10-21

    Arrow Of Time
     …  traveling from the past to the present and into the future
     …  the equations that govern reality don’t have a preference for which way time flows
     …  the arrow of time and a quantity called entropy
     …  It’s the only law of physics that appears to have a preferred direction for time.
     …  So where does the arrow of time that correlates with our perception come from? We don’t know.
     …  Nobody, in fact, understands what will. /16-10-16

    Universe has ten times more galaxies
     …  The observable Universe contains about 2 trillion galaxies
     …  (AW: 2*1012)
     …  galaxies out to distances of 4 billion parsecs (13 billion light years)
     …  theorists had expected the number to be even higher
     …  the current number of galaxies that actually exist now is expected to be much lower than 2 trillion /16-10-16

    Precambrian Research
     …  Tubular microfossils from 2.8 to 2.7 Ga-old lacustrine deposits of South Africa: A sign for early origin of eukaryotes?
     …  Józef Kaźmierczak, Barbara Kremer, Wladyslaw Altermann, Ian Franchi
     …  Archean eukaryotic life
     …  exceptional preservation
     …  to modern siphonous (coenocytic) .. microalgae
     …  our knowledge of early life
     …  evolution of life /16-10-16

    Pabjan, Tadeusz, Anatomia konfliktu, Między nowym ateizmem a teologią nauki
     …  W perspektywie teologicznej wszystko zawdzięcza swoje istnienie Bogu i nie widać żadnej racji za tym, by Stwórca miał powoływać do istnienia jedynie byty materialne, które wykazują podatność na testy empiryczne.
     …  problem jest wieloaspektowy i interdyscyplinarny i w związku z tym
     …  Księga Natury, z której można poznawać Boga równie skutecznie jak z tekstów biblijnych
     …  Nawet dogmaty wiary, w swojej warstwie interpretacyjnej, podlegają ewolucji
     …  wszechświat nie jest chaosem /16-10-14

    Andrzej Wajda, Towering Auteur of Polish Cinema, Dies at 90
     …  The New York Times
     …  But the biggest problems he faced were the practical ones of government disapproval, and sometimes outright censorship, before Poland rid itself of Communist control.
     …  He quoted Mr. Walesa himself, when he ran for president of Poland, to describe his own feelings about making the film. “I don’t want to,” he said, “but I have to.” /16-10-10

    Philosophy Lost Its Way
     …  institutionalization of philosophy
     …  one of the enduring failures of contemporary philosophy
     …  Socratic wisdom, which highlights the role of the philosopher as the non-expert, the questioner
     …  development of the natural sciences, as a field of study clearly distinct from philosophy, circa 1870
     …  grand unity of knowledge
     …  increasing specialization
     …  Philosophers could serve as
    1) synthesizers of academic knowledge production;
    2) formalists who provided the logical undergirding for research across the academy;
    3) translators who brought the insights of the academy to the world at large;
    4) disciplinary specialists who focused on distinctively philosophical problems in ethics, epistemology, aesthetics and the like; or
    5) as some combination of some or all of these.

     …  Philosophy adopted the scientific modus operandi of knowledge production, but failed to match the sciences in terms of making progress in describing the world.
     …  to match the cognitive success of the sciences
     …  We, too, produce research articles. We, too, are judged by the same coin of the realm: peer-reviewed products. We, too, develop sub-specializations far from the comprehension of the person on the street. In all of these ways we are so very “scientific.”
     …  essentially interdisciplinary and transdisciplinary in nature
     …  a Philosopher ought to be something greater and better than another man
     …  There was a brief window when philosophy could have replaced religion as the glue of society; but the moment passed. People stopped listening as philosophers focused on debates among themselves.
     …  Like the sciences, philosophy has largely become a technical enterprise, the only difference being that we manipulate words rather than genes or chemicals.
     …  to be smart, not good. It has been the heart of our undoing /16-10-10

    Deep Learning Is Going to Teach Us
     …  Go has officially fallen to machine, just as Jeopardy did before it to Watson, and chess before that to Deep Blue.
     …  a clear signal
     …  we are entirely unprepared
     …  All work can be divided into four types: routine and nonroutine, cognitive and manual.
     …  Big Data
     …  unlike us, it can then sort through millions of images within a matter of seconds
     …  Amelia .. She can learn in seconds what takes us months, and she can do it in 20 languages. .. she can put 250 million people out of a job, worldwide
     …  Viv
     …  These are questions we need to start asking, and fast.
     …  Decoupling Income From Work
     …  universal basic income
     …  a car that can drive for us
     …  jobs are for machines, and life is for people /16-10-10

    Karl Marx
     …  ideas may help us to understand the economic and political inequality
     …  The new modes of production, communication, and distribution had also created enormous wealth. But there was a problem. The wealth was not equally distributed.
     …  the middle class began sinking to the level of the working class
     …  Marx did, in later years, speculate about the possibility of a peaceful transition to communism
     …  After 1917, communism was no longer a utopian fantasy.
     …  Marx had less money to waste than historians have assumed, and he accepted poverty as the price of his politics.
     …  Marx was an Enlightenment thinker: he wanted a world that is rational and transparent
     …  We created God, and then pretended that God created us.
     …  Otherwise, like the members of the Islamic State today, we become the tools of our Tool.
     …  it’s hard to know what lies on the other side of historical change
     …  Thomas Piketty says about Marx
     …  The Depression and the two world wars had effectively wiped out the owners of wealth, but the thirty years after 1945 rebooted the economic order.
     …  Marx was correct that there is nothing naturally egalitarian about modern economies
     …  Sanders’s proposals to reduce inequality are straight out of Piketty: tax wealth and give more people access to knowledge.
     …  Money matters to people, but status matters more /16-10-10

    Planet at its hottest in 115,000 years thanks to climate change
     …  during an interglacial era, when sea level was 6-9 meters higher than today
     …  the world has heated up at a rate of 0.18C per decade over the past 45 years
     …  There’s a misconception that we’ve begun to address the climate problem
     …  hundreds of trillions of dollars. It’s potentially putting young people in charge of a situation that is beyond their control
     …  fossil fuel companies should be forced to pay for emissions extraction in the same way the tobacco industry
     …  carbon dioxide levels will not drop below the symbolic 400 parts per million (ppm) mark in our lifetimes – the highest concentration of CO2 since the Pliocene era 3m years ago /16-10-07

    UTOPIANS
     …  Not long ago, utopianism was a mark of naiveté or extremism; now pragmatists are denigrated for complacent cynicism.
     …  sordid realities of human nature
     …  “Innumerable millions of human beings were killed in this century in the name of utopia,” the Polish poet Czesław Miłosz
     …  dystopia .. too bad to be practicable
     …  Noww the tide may have shifted
     …  America’s nineteenth-century intentional communities
     …  “a deficit of imagination” in our era
     …  that things will only get worse if we don’t engage in some serious utopian thinking
     …  “Big Oil, Big Coal, Big Agra, Big Pharma” and the “corporate vandals” who “pollute the commons.”
     …  the rejection of capitalism and individualism
     …  a softer version of Communism
     …  1850 Oneidan pamphlet titled “Slavery and Marriage: A Dialogue”
     …  society seemed like something to be invented, rather than merely endured
     …  they never reached a critical mass
     …  Wisława Szymborska
     …  Utopias are, in the philosopher Leszek Kołakowski’s phrase, “anti-human.”
     …  “Four Futures: Life After Capitalism”
     …  tyranny of high expectations
     …  meliorism /16-10-07

    Wisława Szymborska
    Utopia

    Wyspa na której wszystko się wyjaśnia.
    Tu można stanąć na gruncie dowodów.
    Nie ma dróg innych oprócz drogi dojścia.
    Krzaki aż uginają się od odpowiedzi.

    Rośnie tu drzewo Słusznego Domysłu
    o rozwikłanych wiecznie gałęziach.

    Olśniewająco proste drzewo Zrozumienia
    przy źródle, co się zwie Ach Więc To Tak.

    Im dalej w las, tym szerzej się otwiera
    Dolina Oczywistości.

    Jeśli jakieś zwątpienie, to wiatr je rozwiewa.

    Echo bez wywołania głos zabiera
    i wyjaśnia ochoczo tajemnice światów.

    W prawo jaskinia, w której leży sens.

    W lewo jezioro Głębokiego Przekonania.
    Z dna odrywa się prawda i lekko na wierzch wypływa.

    Góruje nad doliną Pewność Niewzruszona.
    Ze szczytu jej roztacza się Istota Rzeczy.

    Mimo powabów wyspa jest bezludna,
    a widoczne po brzegach drobne ślady stóp
    bez wyjątku zwrócone są w kierunku morza.
    Jak gdyby tylko odchodzono stąd
    i bezpowrotnie zanurzano się w topieli.

    W życiu nie do pojęcia.

    The dark universe
     …  Scientists have theories about dark matter and dark energy — and some observations — but both are poorly understood
    1. Is there a dark-matter particle?
     …  Subatomic dark-matter particles, analogous to the particles that make up the visible Universe, would fit nicely into current physics models
     …  Weakly interacting massive particles (WIMPs) are the leading candidates
    2. Does dark matter interact with anything?
     …  the only known effect is gravitational pull
     …  dark matter seems to interact with other dark matter
     …  for signs of dark matter interacting with ordinary matter
    3. Does the cosmological constant explain dark energy?
     …  The simplest explanation for dark energy is that there is a small force that acts in opposition to gravity
     …  theory says that it is 10120 greater than that, a Universe-sized discrepancy
    4. What will eventually happen to the Universe?
     …  big rip /16-10-04

    key to life’s beginning
     …  material from the surface of an asteroid called Bennu.
     …  Slowly, nothing became everything.
     …  For a cell to survive, it requires three ingredients: nucleic acids, like DNA and RNA, to guide its development; amino acids to build proteins; and a lipid envelope to protect it from the elements.
     …  spacecraft to an asteroid, dig up a pristine sample, and bring it back home
     …  official approach to Bennu won’t begin until August of 2018 /16-10-03

    Dark Matter
     …  surprisingly simple relationship between the way galaxies move, and the distribution of ordinary matter within them
     …  if we know where the normal matter is, we know where the Dark Matter is too
     …  Dark Matter and normal matter don’t interact much
     …  about how galaxies form, or about the nature of Dark Matter, or about gravity, or something else
     …  That’s funny /16-10-03

    natural selection of bad science
     …  replication crisis
     …  Sociology, economics, climate science and ecology
     …  studying very complex systems with a dearth of formal mathematical theory creates good conditions for low reproducibility
     …  low statistical power
     …  random noise in the data appears to be a real phenomenon of interest
     …  the pressure to publish is corrosive and anti-intellectual /16-09-27

    Consciousness and Downward Causation
     …  qualia, the irreducibly subjective components of our experience of the world.
     …  zombies are harder to conceive of than you might originally have guessed
     …  respect for the laws of physics, but an insistence that consciousness can’t reduce to the physical
    1. Consciousness cannot be accounted for by physical particles obeying mindless equations.
    2. Human beings seem to be made up — even if not exclusively — of physical particles.
    3. To the best of our knowledge, those particles obey mindless equations, without exception.
    4. Therefore, consciousness does not exist.

     …  emergent, but that word means different things to different people
     …  an electron is determined by the local values of other quantum fields at the position of the electron — and by nothing else /Sean Carroll/16-09-13

    Science Should Stay Clear of Metaphysics
     …  “realists” and “anti-realists.”
     …  “anti-realists” or “empiricists”
     …  van Fraassen
     …  He rescued empiricism from the dead end of logical positivism
     …  rain gods, musical spheres, phlogiston, ether, multiple universes, big bangs, cosmic inflation, dark matter, dark energy, and singularities. A scientist who believes in the existence of these unobserved entities
     …  “empirical adequacy”
     …  By way of example, there is evidence for what goes on inside a proton, but that does not allow us to assume the existence of quarks.
     …  It is a matter of fact whether or not electrons are real.
     …  The physical world is certainly real
     …  The role of science is to create theories that are useful in making predictions about the observable world.
     …  The sole criterion of scientific success is empirical success.
     …  The realist disagrees, “No! Empirical adequacy does not go far enough. The criterion of scientific success is that a theory has to be entirely true.”
     …  Can science explain religion and spirituality?
     …  category mistake /16-09-13

    Noam Chomsky
     …  fails to support Chomsky’s assertions
     …  learning of a child’s first language does not rely on an innate grammar module
     …  ability to classify the world into categories
     …  relations among things
     …  to grasp what others intend to communicate
     …  if you understand what language is, you comprehend a little bit more about human nature
     …  2002 .. computational recursion
     …  a single genetic mutation that occurred be­tween 100,000 and 50,000 years ago
     …  the notion of universal grammar is plain wrong
     …  usage-based linguistics
     …  The grammar must be something they discern beyond the words themselves, given that the sentences share little in common at the word level. /16-09-09

    Art of the lie
     …  Politicians have always lied.
     …  Trump is the leading exponent of “post-truth” politics
     …  “feel true” but have no basis in fact
     …  And he is not alone. Members of Poland’s government assert that a previous president, who died in a plane crash, was assassinated by Russia. Turkish politicians claim
     …  Britain to leave
     …  If, like this newspaper, you believe that politics should be based on evidence, this is worrying.
     …  the heart of what is new: that truth is not falsified, or contested, but of secondary importance
     …  Feelings, not facts
     …  us-versus-them mindset
     …  lies, rumour and gossip spread with alarming speed
     …  NASA scientist says Mars is probably uninhabited; Professor Snooks says it is teeming with aliens. It’s really a matter of opinion.
     …  Pro-truthers stand and be counted
     …  The truth has powerful forces on its side.
     …  who makes contradictory promises to different audiences will soon be exposed on Facebook or YouTube
     …  especially those that draw on science
     …  The deeper worry is for countries like Russia and Turkey /16-09-09

    Smarter brains are blood-thirsty brains
     …  size of two holes at the base of the skull
     …  Brain size has increased about 350% over human evolution, but we found that blood flow to the brain increased an amazing 600% /16-09-07

    nanotube transistors outperform silicon
     …  wireless communications technologies that require a lot of current flowing across a relatively small area
     …  five times faster or use five times less energy /16-09-07

    nuclear fusion
     …  physicists have been trying to build commercially viable nuclear fusion devices for more than 60 years now
     …  at least 100 million degrees Celsius
     …  Princeton Plasma Physics Laboratory (PPPL)
     …  more compact spherical tokamaks
     …  We'll have to wait /16-09-07

    Uber
     …  to the fury of taxi drivers everywhere
     …  self-driving vehicles
     …  people forgo car ownership altogether
     …  It will transform daily life as profoundly as cars did in the 20th century
     …  reshaping cities
     …  reducing road deaths and pollution /16-09-06

    Are we really so modern?
     …  Enlightenment philosophers
     …  Copernicus in 1543
     …  philosopher is a professor of philosophy
     …  discovery of America destroyed established geography, the Reformation destroyed the established Church, and astronomy destroyed the established cosmos.
     …  It’s impossible to imagine what, if anything, could produce a comparable effect on us today.
     …  our universe is actually a simulation run on a computer
     …  One of the most popular names for the unexplainable is God /16-08-31

    What became of the Christian intellectuals?
     …  “nativism,” “reactionary,” even “fascism” appear in political conversation
     …  religious ressentiment
     …  decline of Christian (or “Judeo-Christian”) civilization
     …  They should be intellectuals who speak the language of other intellectuals, including the most purely secular, but they should also be fluent in the concepts and practices of faith.
     …  serious Christian intellectuals
     …  interpreters and watchmen
     …  Finkelstein
     …  What democracy needed was a metaphysical justification
     …  the Christian intellectual was the product of World War II
     …  The Christian intellectuals chose to disappear.
     …  very different authority: the scientist
     …  The term “Judeo-Christian” is almost coterminous with the Cold War
     …  anti-intellectualism in American life
     …  fear is not a Christian habit of mind
     …  a difference, not however between a closed environment and an open one but between environments that are differently closed
     …  dilemmas that Christian intellectuals began to face in the Sixties and still face today, and perhaps no solution at all
     …  you grow more and more public but less and less intellectual
     …  separate-but-equal domains
     …  rise of illiberal and confrontational movements that often seem to be rooted in religious identity
     …  Richard Rorty comment, “Of course the theists can talk, but we don’t have to listen” /16-08-30

    Death and Doctors
     …  The mortality rate of human beings is still 100%
     …  the least attractive stage of human life, the years beyond ninety
     …  thank you, but no.
     …  euthanasia
     …  still the act remains as fearful as ever
     …  absolute irreversibility of the procedure
     …  that is what the patient wanted. But did he?
     …  if you want to die in an acceptable manner, you have to actually try to escape from the hospital to a hospice /16-08-30

    galaxy has been discovered
     …  made almost entirely of dark matter
     …  Dragonfly 44
     …  300 million light years away
     …  scientists have no idea what dark matter is /16-08-29

    Wastefulness of Modern Dining /16-08-29

    A.I.
     …  artificial intelligence .. try to imitate or augment human intelligence
     …  The first is recognition intelligence .. can recognize patterns
     …  The second stage is cognitive intelligence .. making inferences from data.
     …  The third stage will be reached only when we can create virtual human beings, who can think, act, and behave as humans do.
     …  It’s ironic that we define artificial intelligence with respect to its ability to replicate human intelligence
     …  man-machine symbiosis
     …  computers do the best they can (that is being consistent, objective, precise), and humans do our best (creative, imprecise but adaptive) /16-08-28

    Planet orbiting Proxima Centauri
     …  the star closest to the Sun
     …  Earth-sized planet
     …  tiny laser-propelled interstellar probes
     …  Travelling at 20% of the speed of light, they would take about 20 years
     …  The planet orbits its red-dwarf star .. 11.2 days /16-08-25

    brain's "physics engine"
     …  when people watch physical events unfold
     …  on the fly
     …  A better understanding of how the brain runs physics calculations might also enrich robot design. /16-08-24

    hacking the machinery of life
     …  synthetic Escherichia coli genome
     …  factory for new industrial chemicals
     …  synthetic biology
     …  failsafe system /16-08-24

    Werner Herzog
     …  Lo and Behold: Reveries of the Connected World.
     …  Whenever a self-driving car makes a mistake, automatically all the other cars know about it, including future unborn cars.
     …  The ability of cars to develop artificial intelligence is so much greater than the ability of people to keep up with them.
     …  Could it be that the Internet starts to dream of itself?
     …  Elon Musk
     …  the perfect vacation: to infinity and beyond. /16-08-23

    Werner Herzog said of virtual reality
     …  you get tired of it fairly quickly
     …  more convincing was animated films. Digitally created landscapes
     …  So you have the content first, and then the technology follows suit. In this case, we do have a technology, but we don’t have any clear idea how to fill it with content.
     …  I was not caught in a virtual reality is when I travelled on foot.
     …  Our understanding of our brain, of our mind, is in its infancy.
     …  whether we do live in a virtual reality all the time anyway /16-08-23

    Must science be testable?
     …  The general theory of relativity is sound science; ‘theories’ of psychoanalysis, as well as Marxist accounts of the unfolding of historical events, are pseudoscience. This was the conclusion reached a number of decades ago by Karl Popper,
     …  falsifiability
     …  string theory
     …  a general framework – the most mathematically sophisticated one available at the moment – to resolve a fundamental problem in modern physics: general relativity and quantum mechanics
     …  vibrating superstrings, multiple, folded, dimensions of space-time and other features of the theory are impossible to test experimentally
     …  Richard Dawid
     …  speculative, if innovative, type of epistemology
     …  difficult to separate such ‘science’ from New Age thinking, or science fiction,’ said George Ellis
     …  Post-empirical science is an oxymoron
     …  Leonard Susskind .. Popperazzi to label an extremely naive (in his view) way of thinking about how science works
     …  Stephen Hawking has declared philosophy dead
     …  concepts like ‘science’ and ‘pseudoscience’ are complex, multidimensional, and inherently fuzzy,
     …  Ludwig Wittgenstein
     …  to counter true pseudoscience
     …  non-empirical theory assessment
     …  we have come to the limits of what our brains and technologies can possibly do
     …  homeopaths
     …  the luxury of discussing esoteric points of epistemology or fundamental physics /16-08-17

    instant causation
     …  entangled objects do not cause each other to behave the way they do
     …  ignoring the universal speed-of-light limit
     …  this claim is also wrong
     …  nonlocal causality can in general not explain quantum entanglement
     …  Our results drastically narrow down the remaining explanations /16-08-17

    The fight to cheat death is hotting up
     …  eats 1,900 calories a day, 600 fewer than recommended
     …  calorie restriction (CR) .. seems to lessen the risk of cancer and heart disease, to slow the degeneration of nerves and to lengthen life
     …  “longevity escape velocity”, the point where life expectancy increases by more than a year every year
     …  immortality, or a reasonable approximation thereof
     …  ageing may not be simply an accumulation of defects but a phenomenon in its own right
     …  diseases compete to kill people as they age; if one does not get you the next will
     …  Health Nucleus. At prices starting from $25,000
     …  At best it might allow them to age as slowly as the slowest-ageing people do naturally
     …  120 .. natural upper limit
     …  stem-cell therapies
     …  regenerative medicine /16-08-14

    Wood Wide Web
     …  For centuries, fungi were widely held to be harmful to plants, parasites that cause disease and dysfunction. More recently, it has become understood that certain kinds of common fungi exist in subtle symbiosis with plants, bringing about not infection but connection.
     …  hyphae, which infiltrate the soil and weave into the tips of plant roots at a cellular level
     …  mycorrhiza
     …  individual plants are joined to one another by an underground hyphal network
     …  A dying tree might divest itself of its resources to the benefit of the community
     …  young seedling in a heavily shaded understory might be supported with extra resources by its stronger neighbors
     …  plants to send one another warnings
     …  where species begin and end
     …  a forest might be better imagined as a single superorganism
     …  the social networks of plants
     …  which species of fungi were connecting which plants, and thereby to make an unprecedentedly detailed map of the jungle’s social network /16-08-12

    there is no life after death - Sean Carroll
     …  "emergent" /16-07-20

    The more the universe seems comprehensible, the more it also seems pointless. - Steven Weinberg, 1993 /16-07-20

    Islam Evolving
     …  While fully committed to secular Enlightenment values
     …  Secularism is neither historically inevitable, nor a logical necessity, nor a moral imperative.
     …  Secularism cannot claim to be the more democratic option, where it is not what people would prefer.
     …  judges, members of the power elite, as arbiters
     …  individuals only as producers and consumers
     …  denial of the world's most urgent problem, global warming
     …  why do we regard free speech as good?
     …  excesses of neoliberalism
     …  Quran, .. is due to its powerful affirmations of monotheism, and to its concern for social justice.
     …  reinterpretation of the sacred text, rather than by treating it as a human artefact, product of its time and place /16-07-19

    What free will looks like in the brain
     …  decision-making and action
     …  Attention, Perception, & Psychophysics
     …  MRI
     …  what happens in a human brain the moment a free choice is made
     …  parietal lobe, near the back of the brain
     …  frontal cortex
     …  the brain was preparing a purely voluntary action rather than merely following an order
     …  watching as someone weighed short-term rewards against long-term rewards /16-07-18

    Cosmology, God And Why
     …  Sean Carroll
     …  The Big Picture: On the Origins of Life, Meaning, and the Universe Itself
     …  By poetic naturalism, Carroll means adopting the best and most inspiring way of talking about the observable, measurable world, which in the end, he argues, is all there is.
     …  he understands why most people are religious
     …  existential therapy
     …  Bayesian reasoning
     …  Do we really have souls? Carroll concludes we do not. Is death the end for us? Carroll argues that it is.
     …  Anthropic Principle
     …  universe exhibits regularities at all, and in particular that it exhibits regularities that allow for the existence of human beings, has a higher likelihood under theism than naturalism
     …  Terrence Deacon .. scientific understanding of consciousness that can accept a degree of immateriality
     …  Our lives are changing in unpredictable ways
     …  mindfulness that would hopefully promote good behavior
     …  Most of us on this rotating rock find other human beings much more worthy of our lifelong attention than the natural world we live on.
     …  there is and has always been something more to reality than the purely physical /16-07-18

    Astronymy
     …  13585 Justinsmith
     …  onomastic
     …  International Astronomical Union and the International Star Registry
     …  For Aristotle, the soul dissolves when the body corrupts. Many others preferred to believe that nothing dies of what comes to be, and one plausible account of what happens to the soul is that it goes to the stars /16-07-18

    Dinosaurs
     …  mass extinctions
     …  Anthropocene
     …  asteroid
     …  extraterrestrial-impact theory seemed intellectually distasteful
     …  sulfur, not dust
     …  the asteroid was not a lone assassin but struck a global ecosystem already weakened by other injuries
     …  greenhouse gases
     …  crude oil
     …  sudden ignition of underground oil at the Yucatán impact site
     …  soot
     …  If we’re fortunate, we’ll just be naturally selected. /16-07-14

    Loneliness belongs to the photographer
     …  Edward Hopper .. Andy Warhol .. David Wojnarowicz
     …  To be a photographer is to willingly enter the world of the lonely, because it is an artistic exercise in invisibility.
     …  act of predation, as if the street is a savannah and the person with a camera a large cat, silent and hungry,
     …  person with the camera is not hiding but receding. She is willfully removing herself from the slipstream of life; she is making herself into a constant witness, someone who lives to see the lives of others, not to be seen herself.
     …  hoping for anonymity
     …  in our requests to be heard
     …  To practice this art requires first a commitment to self-erasure.
     …  They remind us how much we want to be seen, and also how infrequently we practice the skill of seeing others.
     …  Click: I see you. You are not alone. /16-07-12

    triple sunsets and a super-long year
     …  giant planet orbiting one of the three suns of a triple-star system
     …  Centaurus, about 98 parsecs (320 light years) from Earth
     …  A year on the planet lasts for about 550 Earth years.
     …  extreme configurations can experience exotic behaviour /Nature/16-07-08

    Banach-Tarski paradox
     …  The axiom of choice
     …  counterintuitive consequence
     …  Zorn's Lemma
     …  how are we to decide on the status of an axiom, on whether to accept it or reject it? /16-07-08

    how mind arises from matter or how, in turn, mind acts on the brain
     …  there is no nonphysical soul or ego, or at least no evidence for that
     …  consciousness is a kind of con game the brain plays with itself
     …  The brain is a computer that evolved to simulate the outside world. Among its internal models is a simulation of itself — a crude approximation of its own neurological processes. The result is an illusion. Instead of neurons and synapses, we sense a ghostly presence — a self — inside the head. But it’s all just data processing. “The machine mistakenly thinks it has magic inside it,” Dr. Graziano said. And it calls the magic consciousness.
     …  There is a gap in the explanation where suddenly a miracle seems to occur.
     …  For lack of a precise mechanism describing how minds are generated by brains, some philosophers and scientists have been driven back to the centuries-old doctrine of panpsychism — the idea that consciousness is universal, existing as some kind of mind stuff inside molecules and atoms.
     …  Consciousness doesn’t have to emerge. It’s built into matter, perhaps as some kind of quantum mechanical effect.
     …  perceptronium: atoms arranged so they can process information and give rise to subjectivity
     …  Giulio Tononi, whose integrated information theory
     …  devices as simple as a thermostat or a photoelectric diode might have glimmers of consciousness, a subjective self.
     …  error-correcting circuitry in a DVD player — can be many times more conscious than a human brain
     …  Galatea 2.2.
     …  Philosophers will argue over whether the computer is really conscious or just simulating consciousness — and whether there is any difference.
     …  its own mind-body problem /16-07-05

    language assists human thinking by providing categories and concepts
     …  not the stuff of thought
     …  We don’t actually need language in order to think.
     …  Jean Piaget
     …  cognition to be independent of language
     …  There is a notable irony here. In an earlier age, the absence of language was used as an argument against the existence of thought in other species. Today I find myself upholding the position that the manifest reality of thinking by nonlinguistic creatures argues against the importance of language. /16-07-05

    Jupiter
     …  In 1543 Nicolaus Copernicus proposed, in a mathematically rigorous way, that the Earth is not the centre of the universe
     …  Juno will become a 68th satellite of Jupiter on July 4th, arriving almost five years after it was launched
     …  250,000 kilometres an hour
     …  Assistance from Earth will be impossible, for radio signals from mission control in California take nearly an hour to reach it.
     …  Europa, which is thought to have beneath its icy surface a liquid-water ocean that might conceivably support life
     …  mysterious thing is Jupiter’s origin
     …  whether the planet has a core /16-07-01

    March of the machines
     …  “the discovery of this mighty power” has come “before we knew how to employ it rightly”
     …  AI
     …  “Terminator”
     …  deep learning
     …  Apple’s voice assistant, Amazon’s shopping recommendations and Tesla’s self-driving cars
     …  AI systems are impressive, they can perform only very specific tasks: a general AI capable of outwitting its human creators remains a distant
     …  technology ultimately created more jobs than it destroyed
     …  empathy and human interaction—traits that are beyond machines
     …  “basic income”, paid to everybody /16-06-30

    explaining the universe through testing and factual observation
     …  the particular mind-set that scientists have
     …  healthy skepticism
     …  experimental mind
     …  nothing is ever completely settled
     …  The scientific orientation has proved immensely powerful.
     …  double our lifespan
     …  people often resist
     …  Bad science has a pattern, and helping people recognize the pattern
     …  Having a scientific understanding of the world is fundamentally about how you judge which information to trust.
     …  neuroscience and computerization are shaping understanding of everything from free will to how art and literature have evolved over time
     …  Education may expose people to science, but it has a countervailing effect as well, leading people to be more individualistic and ideological. /16-06-20

    We are living in a computer simulation
     …  not in the real world
     …  Elon Musk
     …  The likelihood that we are living in “base reality,” he concluded, was just “one in billions.”
     …  virtual reality and the mapping of the human brain
     …  our far-future descendants
     …  consciousness can be simulated in a computer
     …  millions of ancestor simulations could be run by a single computer in the future
     …  the simulation argument bears some resemblance to the one made by René Descartes .. undetectable “evil demon”
     …  posthuman
     …  cheat death by uploading their minds into computers
     …  Watson has won “Jeopardy!”
     …  nervous system of a roundworm
     …  theological implications in the idea that we are living in a simulation
     …  nested simulations .. in a recursive loop
     …  afterlife may turn out to be an infinite journey into ever-higher levels of simulation
     …  it gives atheists a way to talk about spirituality
     …  impossibility of ultimate knowledge about the universe in which we live /16-06-13

    Quantum Questions
     …  quantum computers made by D-Wave Systems
     …  which queries might benefit from these quantum machines
     …  100 million times faster
     …  the catch-22 of quantum computing: The quantum features only work when they’re not being observed, so observing a quantum computer to check if it’s exploiting quantum behavior will destroy the quantum behavior being checked.
     …  quantum annealers should be able to outperform classical computers in certain narrow computing domains .. protein folding .. route planning
     …  to do an impossible calculation
     …  Quantum factorization of 56153 with only 4 qubits
     …  maximum clique problem
     …  NP-hard optimization problem
     …  Toward Better Tests /16-06-13

    good teacher
     …  The secret to stellar grades and thriving students is teachers.
     …  myth that good teachers are born, not made
     …  to make ordinary teachers great
     …  Teaching is a mass profession: it cannot grab all the top graduates
     …  schools neglect their most important pupils: teachers themselves
     …  Good teachers set clear goals, enforce high standards of behaviour and manage their lesson time wisely
     …  where pupils do best, for example Finland, Singapore and Shanghai
     …  Money is less important than you might think /16-06-10

    Switzerland's voters rejects basic income plan
     …  77% opposed the plan, with only 23% backing it.
     …  The supporters had also argued that since work was increasingly automated, fewer jobs were available for workers.
     …  Switzerland is the first country to hold such a vote. /16-06-06

    basic income for all Swiss citizens
     …  an unspecified minimum income sufficient to insure a “dignified existence”
     …  getting a salary without working for it is a civil right
     …  Thomas More’s “Utopia”
     …  Libertarians have homed in on an income guarantee as a low-friction, low-bureaucracy way to take care of the poor
     …  well-paying jobs are disappearing, either to other countries with cheaper labor or to automation,
     …  a mere two per cent of workers would stop working entirely
     …  They are debating whether they should work less. /16-06-06

    Stephen Hawking angered supporters of Donald J. Trump
     …  Hawking called Trump “a demagogue who seems to appeal to the lowest common denominator,”
     …  Moments after Hawking made the remark, Google reported a sharp increase in searches for the terms “demagogue,” “denominator,” and “Stephen Hawking.”
     …  Trump’s campaign manager, Corey Lewandowski, said. “If Professor Hawking wants to do some damage, maybe he should try talking in English next time.”
     …  Hawking attempted to clarify his remark about the presumptive Republican Presidential nominee, telling a reporter, “Trump bad man. Real bad man.” /16-06-01

    Babies are born helpless, which might explain why humans are so clever
     …  Human intelligence is a biological mystery
     …  much cleverer than their closest living relatives, the chimpanzees, they are also much cleverer than seems strictly necessary
     …  to prove Pythagoras’s theorem
     …  power-hungry brains suck up around a quarter of their body’s oxygen supplies
     …  Perhaps intelligence is a result of sexual selection
     …  it is an ornament that, by virtue of being expensive to own, proves its bearers’ fitness
     …  simply humanity’s good fortune
     …  Another idea is that human cleverness arose out of the mental demands of living in groups whose members are sometimes allies and sometimes rivals
     …  another idea .. humans may have become so clever thanks to another evolutionarily odd characteristic: namely that their babies are so helpless
     …  feedback loop, in which the pressure for clever parents requires ever-more incompetent infants /16-05-30

    A molecule made by trees can seed clouds, suggesting that pre-industrial skies were less sunny than thought
     …  the masking effect, and in turn the warming effects of carbon dioxide, might have been overestimated
     …  Cosmics Leaving Outdoor Droplets (CLOUD)
     …  to speculate whether trees emit these compounds in part because there is a benefit to them in making their own climate
     …  This really does touch on the Gaia hypothesis /Nature/16-05-26

    Bridge Finite-Infinite Divide
     …  A surprising new proof is helping to connect the mathematics of infinity to the physical world
     …  infinite objects exist
     …  Ramsey’s theorem for pairs
     …  RT22
     …  finitistically reducible
     …  partial realization of Hilbert’s program
     …  to weave infinity completely into the fold of finitistic mathematics
     …  Banach-Tarski paradox
     …  does mathematics ultimately have its roots in reality?
     …  the paradise which Cantor has created for us
     …  Kurt Gödel
     …  When looking for a set of axioms that yield all true mathematical statements and never contradict themselves, you always need another axiom
     …  between the idealization and the concrete realizations
     …  infinite sets exist insofar as we know how to reason about them
     …  how exactly do they play a role? And what is the connection?
     …  mathematicians and philosophers
     …  the picture has gotten quite complicated /16-05-26

    Christian preacher who became an atheist
     …  a self-proclaimed "extremist", Dan Barker
     …  66-year-old now defends a life free of any supernatural authority
     …  I would counsel people to pray for healing. That’s dangerous.
     …  God: the Most Unpleasant Character in All Fiction
     …  The God Delusion
     …  Religion is really a tool to control
     …  I believed that a snake spoke human language. I believed that a fish swallowed a human being. It was stupid. Something happens to the brain. You get delusional.
     …  “The non-religious, the secular, the freethinker. When are we going to be taken seriously enough, when right now about a quarter of our population on this continent is thoroughly non-religious?” /16-05-25

    Homo Sapiens 2.0
     …  We need a species-wide conversation about the future of human genetic enhancement
     …  After 4 billion years of evolution by one set of rules, our species is about to begin evolving by another.
     …  everybody wants to have cancers cured
     …  want to live longer, healthier
     …  what it means to be human
     …  the revolution has already begun
     …  inevitable. Timing is the only variable
     …  In our world of exponential scientific advancement
     …  the first state-authorized genetically altered babies will be born in the UK later this year
     …  Preimplantation genetic selection
     …  The genetics of intelligence, for example, is influenced by thousands of genes.
     …  we’ll be able to predict people’s IQs from their genomes with significant accuracy within a decade
     …  Olympic sprinters or winners of the Fields Medal
     …  CRISPR
     …  conflicts between groups and countries, the potential dangers to the species as a whole are also very real
     …  dangerous genetic monoculture
     …  But the alternative is far worse. /Kurtzweil/16-05-20

    kant
     …  the absurdity of equating Soviet Marxism with Marx
     …  Fichte being the key
     …  Kant’s idea of natural religion
     …  is Kantianism now the default position of most contemporary ethics?
     …  the Truth about ethics was some form of utilitarianism
     …  deontology
     …  Rawls is the greatest
     …  rational intuitionism
     …  Kant was a constructivist about mathematics, but not about ethics.
     …  a set of moral “facts” that are independent of our procedures in making decisions
     …  Our procedures of deliberation are not ways of finding out independent moral truths but instead ways of “constructing” these truths, in the process of deciding what to do.
     …  what we ought to do
     …  Formula of the Law of Nature
     …  the general conditions of human life
     …  judgment as a special faculty or talent of the mind
     …  formula whose validity is equated with our freedom
     …  it does not “divide the heart from the head”
     …  Kant does not think that any being, not God, not we ourselves, authors or legislates
     …  “lies in the nature of things, the essence of things.”
     …  central to morality is rational self-constraint (acting from duty)
     …  how freedom is possible is a deep philosophical problem
     …  I don’t think Kant’s approach to religion is any longer viable in its original form.
     …  the general happiness (or whatever the end is)
     …  We can’t coherently deny, or even decline to affirm, that we are free.
     …  “Freedom can never be comprehended, nor even can insight into it be gained” /16-05-09

    measure prosperity
     …  WHICH would you prefer to be: a medieval monarch or a modern office-worker?
     …  gross domestic product (GDP)
     …  Faulty speedometer
     …  its original purpose was to measure the economy’s capacity to produce
     …  Stop counting, start grading
     …  GDP-plus
     …  inclusion in GDP of unpaid work in the home
     …  measure changes in the quality of services
     …  skills, brands, designs, scientific ideas and online networks—would all be valued /16-05-08

    quantum computer available for anyone to play with
     …  May 4th, IBM announced
     …  power comes from two counterintuitive phenomena: superposition and entanglement
     …  IBM’s current offering is a five-qubit processor
     …  and the chip will execute it
     …  quantum computers answer questions probabilistically rather than definitel
     …  they are unlikely ever to fit on a desktop or into a smartphone /16-05-08

    you’re a mindless robot with no free will
     …  we may confabulate reality and rationalize irrational behavior
     …  what we believe to be a conscious choice may actually be constructed, or confabulated, unconsciously after we act — to rationalize our decisions. A trick of the mind. /16-05-08

    Human embryos grown in lab for longer than ever before
     …  up to 13 days after fertilization
     …  reignite ethical debate
     …  ban research on human embryos that are more than 14 days old
     …  we know more about fish and mice and frogs than we know about ourselves
     …  human embryos donated by an in vitro fertilization (IVF) clinic
     …  using data from a 1956 study
     …  have identified a group of cells that shows up in the embryo around day 10 and disappears around day 12 .. This is like discovering a new organ in your body
     …  The implantation process is a big black box
     …  14 days marks the beginning of gastrulation in humans. It is also around the latest point at which an embryo can split into identical twins. After this time, the logic goes, a unique individual comes into being. /Nature/16-05-08

    Standard Model
     …  The basic ingredients of the Standard Model are easy to list, though understanding their properties is more difficult.
     …  Three pairs of quark fields, three pairs of lepton fields, three interaction fields, plus the Higgs field: that’s it
     …  the differences between matter and force, and between matter and antimatter
     …  the spin-statistics theorem. I’ve wracked my brain trying to come up with an intuitive explanation of it, to no avail
     …  bosons can collapse down to a small region. Thus, matter is made of fermions.
     …  All the matter you see and experience is made up of these three fermions.
    • The world is made up of quantum fields, and particles are the excitations of quantum fields.
    • The excitations of quantum fields have spin (intrinsic angular momentum).
    • Some excitations have half-integer spin: these particles are called fermions.
    • Some excitations have integer spin: these particles are called bosons.
    • Fermions obey the Pauli Exclusion Principle, which means they cannot be in the same state (including the same place at the same time).
    • Bosons do not obey the Pauli Exclusion Principle, which means they can be in the same state (including piling up in the same place).
    • Leptons (including electrons) and quarks are fermions; photons, gluons, and W/Z particles are bosons, as is the Higgs boson.
     …  not much of the antimatter type. Why is that?
     …  quark. There is no known pattern that explains the differences in the masses.
     …  there is a symmetry of Nature
     …  Forces are local symmetries in action
     …  we have no idea why they have this color or this symmetry
     …  I find that rather strange and wonderful to think about /16-05-06

    Is treasure buried beneath the mountains of Poland?
     …  the Nazis still considered Lower Silesia to be safe ground /16-05-05

    Law, not culture, is Europe’s answer to Islam
     …  the historically Christian countries of Europe would be making a mistake if they responded to the Muslim influx by erecting new barriers or raising high the banner of cultural nativism.
     …  new Muslim citizens, and indeed for practitioners of all religions including the various forms of Christianity, within a framework that is ordered not by any particular religion or culture but by the universal principles of secular law.
     …  Europe must now find some other way to dynamically incorporate the world of Islam without diluting its devotion /16-04-30

    Wikipedia is a voluntary organization
     …  such systems usually end up looking a lot like 20th century bureaucracies
     …  a complexity scientist
     …  the emergence of social hierarchy
     …  Iron law of oligarchy
     …  a fairly small number of Wikipedia editors exert a major influence
     …  that editing inequality is increasing over time
     …  start with a decentralized democratic system, but over time you get the emergence of a leadership class /16-04-29

    genetic technology that can kill off mosquito could eradicate malaria. But is it too risky to ever use?
     …  DNA contains a genetic element that has “a capacity to spread” at a “disproportionately high” rate
     …  artificial “selfish” gene capable of forcing itself into 99 percent of an organism’s offspring instead of the usual half
     …  this particular gene causes female mosquitoes to become sterile, within about 11 generations
     …  The mosquitoes I saw were created as
     …  the self-annihilating mosquitoes could be unleashed in 2029
     …  The technology creates risks that society has never before had to consider
     …  if the selfish DNA should jump the species barrier
     …  Rapid-fire technical advances are occurring thanks to CRISPR
     …  FBI is looking into
     …  is it ethical to eliminate any part of nature on purpose? Are you asking in a Darwinian way or a theological way?
     …  it’s a species competition between us and the mosquito
     …  what species do have is “fitness”
     …  specialty is selfish genetic elements
     …  turned into an extinction device
     …  how something very bad for mosquitoes could also be spread by them
     …  selfish gene that is harmless if one copy is present but causes sterility if two copies are /16-04-26

    gender can be fluid
     …  Boy or girl? It’s the most binary question in biology .. But in reality
     …  58 gender specification options
     …  Agender, Bigender, Intersex, Gender Fluid, Gender Questioning, Non-binary, Pangender, Two-spirit
     …  parthenogenic species
     …  hermaphrodites
     …  pseudo-hermaphrodites
     …  sequential hermaphrodites
     …  If that dominant individual dies, the highest-ranking of the opposite sex changes sex and assumes the role.
     …  The sine qua non of human sex designation in humans is chromosomal
     …  XYY, XXY, XXX, X, or XXYY
     …  chromosomal sex and gonadal/anatomical sex can disagree
     …  Gender in humans is on a continuum
     …  our minds are very resistant to continua
     …  we think categorically
     …  processes faces according to gender, within 150 milliseconds
     …  Boy or girl? Maybe things will be different in 350 years, or 3,500 years. It’s possible. Of course, by then, maybe all anyone will be asking is which operating system you had your consciousness uploaded to. /16-04-21

    Adam Zagajewski
     …  being awarded the 2016 Jean Améry Prize for European essay writing, Eurozine publishes
     …  From Lvov to Gliwice, from Gliwice to Krakow
     …  only in ancient Krakow
     …  Hapsburg empire
     …  Kolakowski distanced himself from his manifesto
     …  But what is poetry?
     …  Czeslaw Milosz's work, as rich intellectually as it is poetically
     …  Perhaps one day ardour will return to our bookstores, our intellects. /16-04-14

    Computer generated Rembrandt
     …  3-D-printing technology to produce what, at a glance, looks very like a previously unknown early portrait, of a thirties-ish man, by Rembrandt.
     …  150Mpix
     …  The sitter has a sparkle of personality but utterly lacks the personhood /16-04-14

    astrology
     …  By fetishising mathematical models, economists turned economics into a highly paid pseudoscience
     …  The failure of the field to predict the 2008 crisis
     …  computing technology made financial astrology explode in the 1970s and ’80s
     …  Faith in a divine, invisible hand, made visible by mathematics.
     …  In 101 BCE, Emperor Wudi
     …  It’s time to stop wasting our money and recognise the high priests for what they really are: gifted social scientists who excel at producing mathematical explanations of economies, but who fail, like astrologers before them, at prophecy. /16-04-06

    the right of the terminally ill to die when and how they choose, and with the support of clinicians
     …  will thus be allowed in California from June 9th
     …  predicts that in the first year fewer than 450 seriously ill individuals will ask the state’s Medicaid programme for a prescription of lethal drugs. And not all will take the pills they are prescribed. /16-04-05

    Syn3.0
     …  Richard Feynman .. “What I cannot create, I do not understand.”
     …  Syn1.0 was the first human-engineered genome to be capable of controlling a cell
     …  Syn3.0 has the smallest genome of any self-replicating organism
     …  last universal common ancestor—the simplest, most minimalistic organism
     …  who claims that she or he understands how a cell works is
     …  doesn’t know what nearly a third of its genes do
     …  what functions are fundamental to life
     …  Its DNA provides just enough information for a single organism to sustain its own life, but too little to insure the long-term survival of the species. /16-04-05

    mystery of mathematics is its lack of mystery
     …  In math, we can really understand things, in a deeper way than we ever understand anything else.
     …  a dirty secret in mathematics is that many unsolved problems have a similar flavour: they’re less about mysterious coincidences than about the lack of them
     …  196,883
     …  as you get further away from physics, math becomes just a disorganised mess of propositions
     …  even the parts of math that look far removed from physics are indirectly inspired by our experience with the physical world
     …  peculiarities of the human brain /16-04-04

    circular economy
     …  new relationship with our goods and materials
     …  Quality is still associated with newness not with caring
     …  substituting manpower for energy
     …  consumers become users and creators
     …  remanufacturing and repair of old goods
     …  finding ways to disassemble material blends at the atomic level
     …  The linear economy is driven by 'bigger-better-faster-safer' syndrome — in other words, fashion, emotion and progress.
     …  Cleaning a glass bottle and using it again is faster and cheaper than recycling
     …  Autolib car-sharing schemes free users from the demands of ownership
     …  intelligent decentralization /Nature/16-04-04

    Antarctic ice sheet is much less stable
     …  by warming ocean currents — which can eat at the underside of the ice sheet
     …  Before the last ice age began 130,000–115,000 years ago, for instance, sea levels were 6–9 metres higher than today — yet atmospheric carbon-dioxide levels were about 30% lower. And 3 million years ago, when CO2 levels roughly equalled today’s, the oceans may have been 10–30 metres higher. /Nature/16-04-04

    emergence of life’s complexity
     …  “To imagine a language is to imagine a form of life.” —Ludwig Wittgenstein, Tractatus Logico-Philosophicus (1921)
     …  Jeremy England
     …  dissipative adaptation
     …  self-organize and emerge from simpler things, including inanimate matter
     …  how do you say “life” in physics? Some have argued that the word is untranslatable. But maybe it simply needed the right translator.
     …  something like purpose emerges
     …  In biology, systems are fine-tuned to act.
     …  creation, entails a process of giving names to things
     …  It could be easier for things like proteins and enzymes to emerge than we’d thought.
     …  in 1999, Crooks showed that a small open system driven by an external source of energy could change in an irreversible way, as long as it dissipates its energy as it changes.
     …  Darwinian natural selection could be recast as a special case of the more generalized phenomenon of dissipative adaptation
     …  As systems dissipate energy, they drift in an irreversible direction and by doing so become “exceptional”
     …  the very beginning of life looks a bit more like a ramp or stairway with lots of smaller incremental changes that point in the right direction
     …  emergent computation
     …  without receiving any design instructions
     …  Jeremy is hoping that he can avoid thinking about the chemistry and see the abstract essentials of life emerging as a physical necessity
     …  Umberto Eco, “translation is the art of failure.”
     …  England .. in Commentary magazine last year: “There is more than one viable language for describing the world, and God wants man to speak all of them.” /16-03-28

    pseudolaw, a weird little cousin of pseudoscience
     …  conspiracy-theory versions of science and medicine
     …  legal version of this phenomenon, not as visible as creationism or anti-vaccine activism but in many ways as destructive
     …  Believers are typically intelligent
     …  A typical pseudolegal scheme promises to help you avoid ever having to pay taxes by invoking some obscure legal principle
     …  complex rituals such as using precise punctuation and lowercase letters when writing your name (‘john-stephen :smith’)
     …  Latin is usually involved
     …  pseudoscience and pseudolaw have common roots in irrational thinking
     …  secret knowledge
     …  snake oil /16-03-28

    473 genes, Syn 3.0
     …  When it comes to genome size, a rare Japanese flower, called Paris japonica, is the current heavyweight champ, with 50 times more DNA than humans.
     …  in California
     …  Craig Venter report engineering a bacterium to have the smallest genome
     …  essentials needed to survive and reproduce
     …  It’s an important step to creating a living cell where the genome is fully ?defined,
     …  the function of 149 of Syn 3.0’s genes—roughly one-third—?remains unknown
     …  basic biology of life
     …  by stripping nonessential genes from Syn 1.0
     …  Mycoplasma genitalium 525
     …  experiment with Syn 3.0 in the future
     …  With a total of 531,000 bases, the new organism’s genome isn’t much smaller than that of M. genitalium, with 600,000 bases. But M. genitalium grows so slowly
     …  Syn 3.0, by contrast, has a doubling time of 3 hours
     …  this is the ultimate minimum genome /Science/16-03-25

    After the fact
     …  In the history of truth, a new chapter begins
     …  the insistence, chiefly by Democrats, that some politicians are incapable of perceiving the truth because they have an epistemological deficit: they no longer believe in evidence, or even in objective reality.
     …  to accept the settled science of climate change
     …  "The Internet of Us: Knowing More and Understanding Less in the Age of Big Data"
     …  no one would know how to know
     …  I Google, therefore I am not
     …  in the hands of God. Trial by jury places judgment in the hands of men. It requires a different sort of evidence: facts.
     …  Between the thirteenth century and the nineteenth, the fact spread from law outward to science, history, and journalism.
     …  Somewhere in the middle of the twentieth century, fundamentalism and postmodernism, the religious right and the academic left, met up: either the only truth is the truth of the divine or there is no truth; for both, empiricism is an error.
     …  he place once held by “facts” is being taken over by “data.”
     …  whether anything, in the end, can really be said to be fully proved
     …  the idea that science is just another faith /16-03-22

    Noam Chomsky What Kind of Creatures Are We?
     …  the apparent scope and limits of human cognitive capacities and what the human mind can seriously investigate
     …  from language and mind to society and politics
     …  libertarian socialism /16-03-21

    Anti-Packaging Movement
     …  Recycling is nice, but some shop owners are trying to eliminate waste altogether.
     …  If you don’t use new plastic, paper or metal to begin with, you won’t have to dispose of it.
     …  Rethinking and reinventing groceries in the interest of the environment would require the cooperation of manufacturers, as well as consumers. /16-03-15

    Mateusz Hohol: W sobotę po raz kolejny dowiedziałem się, że Michał Heller za kasę z Nagrody Templetona założył Centrum Nauki Kopernik (w Wawie). Nic w tym dziwnego (często się ta ignorancja powodowana podobnymi nazwami zdarza), tyle że tym razem się tego dowiedziałem z oficjalnego listu gratulacyjnego najjaśniejszego Prezydenta RP do Michała Hellera odczytanego w dniu jego 80 urodziny. Super. Panie Prezydencie i Jego Najjaśniejsza Kancelario - Heller założył Centrum Kopernika Badań Interdyscyplinarnych (w Krakowie). Jak się komuś składa życzenia urodzinowe to trzeba pamiętać, że diabeł tkwi w szczegółach. Szczególnie jak się kawał czasu spędzało na tej samej ulicy Brackiej (tej w Krakowie), na której facet któremu się życzy dalej spędza sporo czasu. /16-03-15

    Could black holes be the dark matter?
     …  black-hole (BH) binary detected by LIGO may be a signature of dark matter
     …  about 5 mergers per cubic gigaparsec per year /Sean Carroll/16-03-14

    human nature is a superstition
     …  species vary in all respects at any moment in time
     …  sceptical of the thought that species have "natures"
     …  Stephen Pinker's 2002 book The Blank Slate: The Modern Denial of Human Nature
     …  Four-year-olds tend to think that each species has an internal "essence"
     …  all dogs possess a "doggy" essence
     …  modern biology denies that these essences are real
     …  widely shared error in our intuitive ways of thinking about animals and plants
     …  Genome editing is, after all, a considerable technical achievement.
     …  Nature cannot do the ethical work intended for it. /16-03-13

    P-value
     …  Misuse
     …  not only the data analyses that produced statistically significant results
     …  but all statistical tests
     …  the ban on publishing papers that contain P values instituted by at least one journal, could be counter-productive
     … 
     …  better understanding of the P value will not take away the human impulse
     …  “People want something that they can't really get,” he says. “They want certainty.” /Nature/16-03-08

    Left and Right
     …  twisting snails
     …  the earliest molecules that make us asymmetrical
     …  one in every 10,000 people, who have a condition called situs inversus
     …  We begin life as a single fertilised cell, which divides again and again into the trillions of the adult form. At what point in that process does left begin to differ from right?
     …  cilia
     …  some earlier symmetry-breaking event
     …  a gene called Ldia2
     …  called an F-molecule
     …  might affect the layout of organs, but does it, say, influence the asymmetry of the human brain, or whether people are right-handed or left-handed? /16-03-06

    human hand was 'designed by Creator'
     …  PLoS ONE
     …  triggered a debate over the quality of editing and peer review at the journal
     …  “Hand coordination should indicate the mystery of the Creator’s invention”
     …  we are not native speakers of English, and entirely lost the connotations of some words such as ‘Creator’. I am so sorry for that.
     …  it should have included a citation to an appropriate deity
     …  journal quality
     …  We apologize for the errors and oversight leading to the publication of this paper. /Nature/16-03-06

    Could chimpanzees have religion?
     …  repeated activity with no clear link to gaining food or status – it could be a ritual
     …  chimp approaches our mystery tree and pauses for a second. He then quickly glances around, grabs a huge rock and flings it full force at the tree trunk
     …  chimps throw rocks in displays of strength to establish their position in a community.
     …  Sacred trees
     …  trees with particularly good acoustics
     …  West African people have stone collections at “sacred” trees /16-03-04

    What does it mean to care about future generations?
     …  future generations should be able to live as comfortably as do current generations in the developed world
     …  scientific knowledge, infrastructure and sophisticated economic, legal and educational institutions
     …  many people have 'other-regarding preferences'
     …  conditional cooperators
     …  the threat of being named publicly (within the group) as a defector is enough to keep such people cooperating
     …  Delay-dependent risk tolerance
     …  a shift to green-energy sources — will meet strong opposition
     …  Zurich residents use less energy than the average person in Switzerland, who in turn uses only about half of that used by most US residents
     …  it is possible to mobilize the better angels of our nature /Nature/16-03-02

    Noam Chomsky
     …  10 principles of oligarchy

     …  1. Reduce Democracy
     …  protect the wealthy from too much democracy
     …  2. Shape Ideology
     …  3. Redesign the Economy
     …  Alan Greenspan testified to Congress about the benefits of promoting "job insecurity"
     …  4. Shift the Burden
     …  The American Dream in the 1950s and 60s was partly real
     …  the plutonomy and the precariat
     …  5. Attack Solidarity
     …  1950s was able to make college essentially free
     …  6. Run the Regulators
     …  lobbying
     …  7. Engineer Elections
     …  8. Keep the Rabble in Line
     …  9. Manufacture Consent
     …  Obsessive consumers are not born, they're molded by advertising. The goal of directing people to superficial consumption as a means of keeping people in their place
     …  also election campaigns
     …  10. Marginalize the Population
     …  11. Dump Massive Funding into Militarism. Why should this be included? /16-03-02

    AltSchool
     …  micro-school
     …  a highly tailored education that uses technology to target each student’s “needs and passions.” Tuition is about thirty thousand dollars a year.
     …  software developed by AltSchool which captures, in minute detail, a student’s progress
     …  to capture every word, action, and interaction, for potential analysis
     …  the kinds of insights that can be gleaned from big data
     …  how little education had changed since he began school
     …  A three-year-old today isn’t that different
     …  because of technology, “a thirteen-year-old is really different.”
     …  to sketch out in code potential solutions to “robot tasks”—routine aspects of a teacher’s job that don’t require teaching skills
     …  a robot tutor in the sky that can semi-read your mind and figure out what your strengths and weaknesses are
     …  teachers who added digital tools were judged to be more effective educators in general
     …  Machines have become quite good at measuring the acquisition of arithmetical operations, but they are much less good at quantifying such skills as creativity or flexibility
     …  It holds that children should be prepared for the workplace of the future—and that the workplace of the future will demand individuality, creativity, collaboration, and critical thinking. /16-03-01

    Polish scientists protest over plan to log in Białowieża Forest
     …  European bison in Białowieża Forest
     …  Jacek Krzemiński, says that there is no commercial incentive /Nature/16-02-26

    hidden reality exists
     …  they have only ruled out a specific class of theories in which the hidden reality of any particle is local, and not influenced by something far away
     …  everything depends on everything
     …  Bohm is back
     …  non-local interactions /16-02-25

    Brain Is Computing the Mind
     …  ways of seeing the brain, ways of controlling brain circuits, ways of trying to map the molecules of the brain
     …  thoughts and feelings and maybe even consciousness
     …  being a pessimist, we should still always hold open the possibility that it will be incomprehensible
     …  not going to be infinitely complex
     …  biology is not a fundamental science
     …  other genes modulate it
     …  it’s a huge combinatorial explosion
     …  I don’t think the maps of the brain equal the understanding of the brain
     …  your brain already has that information in advance. Wouldn’t it be interesting to know what’s generating that information?
     …  much processing that we have no access to, and yet, it’s so essential to the human condition
     …  for small parts of mammalian brains, we’re ready to start mapping them and trying to understand how they’re computing.
     …  subtly shifting the activity levels of certain circuits in the brain
     …  subtly tuning the immune system to fight off a cancer /Edge/16-02-25

    thrift as liberation rather than as deprivation
     …  a cheap, small, fuel-efficient automobile
     …  Mustachianism is “financial freedom through badassity.
     …  saved enough money in his twenties, working as a software engineer, to retire at age thirty.
     …  a wealthy man, without want, but he and his wife, who have one child, spend an average of just twenty-four thousand dollars a year.
     …  human optimization machine, the quintessence of that urge, which is stronger in some of us than in others,
     …  elevate principle over appetite
     …  I’ve become irrationally dedicated to rational living
     …  carbon tax
     …  If you can’t afford to lose it, you can’t afford to buy it yet—otherwise the object owns you rather than vice versa /16-02-24

    edit your children’s genes?
     …  The changes to their genomes would almost certainly be passed down to subsequent generations, breaching an ethical line that has typically been considered uncrossable.
     …  prenatal genetic screening to check for conditions such as Down’s syndrome
     …  to select embryos that do not have certain disease-causing mutations
     …  Mitochondrial replacement therapy .. was approved
     …  What sort of world would these procedures create
     …  CRISPR is a bullet train that has left the station — there’s no stopping it
     …  In the United States, pregnancies in which a Down’s syndrome diagnosis is made are terminated in 67–85% of cases.
     …  Uneven access
     …  People without disabilities consistently underestimate the life satisfaction of those with them. /Nature/16-02-23

    Meditation Changes the Brain and Body
     …  mindfulness meditation .. unlike a placebo, it can change the brains of ordinary people and potentially improve their health.
     …  much mindfulness is needed to improve health /16-02-22

    Homeopathy effective for 0 out of 68 illnesses
     …  no discernible convincing effects beyond placebo
     …  there was no reliable evidence from research in humans that homeopathy was effective for treating the range of health conditions considered /16-02-22

    5G
     …  to offer users no less than the “perception of infinite capacity”
     …  Rare will be the device that is not wirelessly connected, from self-driving cars and drones to the sensors, industrial machines and household appliances that together constitute the “internet of things” (IoT).
     …  10 gigabits per second and response times (“latency”) of below 1 millisecond
     …  extremely high radio frequencies .. mmWave
     …  indoors: smartphone users are increasingly using Wi-Fi connections for calls and texts as well as data /16-02-19

    Cambrian explosion
     …  An evolutionary burst 540 million years ago
     …  Ediacaran period
     …  Animal life at this point was simple, and there were no predators.
     …  give way to a world ruled by highly mobile animals
     …  rise in oxygen
     …  some key evolutionary innovation, such as vision
     …  earlier theories were overly simplistic
     …  the Cambrian explosion actually emerged out of a complex interplay between small environmental changes
     …  evolutionary arms race
     …  The advent of pervasive carnivory, made possible by oxygenation, is likely to have been a major trigger
     …  energy-hungry innovations as muscles, nervous systems
     …  The role of oxygen in the origins of animals has been heavily debated /Nature/16-02-18

    Gravitational Waves Exist
     …  Just over a billion years ago, many millions of galaxies from here, a pair of black holes collided.
     …  a hundred times more energy than all the stars in the universe combined
     …  Then space and time became silent again.
     …  The waves rippled outward in every direction, weakening as they went. On Earth, dinosaurs arose, evolved, and went extinct.
     …  Albert Einstein, one of the more advanced members of the species
     …  LIGO consists of two facilities, separated by nearly nineteen hundred miles
     …  This is a completely new kind of telescope
     …  we are pretty ignorant about what’s going to come through /16-02-12

    gravitational-wave detection
     …  After more than a decade of searching
     …  Advanced Laser Interferometer Gravitational-Wave Observatory (LIGO) announced — after months of speculation
     …  from the collision of two black holes about .. 1.3 billion light-years
     …  Einstein's general theory of relativity
     …  14 September 2015
     …  Hunt for gravitational waves /Nature/16-02-12

    Every culture ever studied has been found to make music
     …  flutes carved from mammoth bone some 43,000 years ago
     …  analyzing scans of the auditory cortex and grouping clusters of brain cells with similar activation patterns, the scientists have identified neural pathways that react almost exclusively to the sound of music — any music.
     …  Other sounds .. leave the musical circuits unmoved.
     …  Why do we have music?
     …  the speech and music circuits are in different parts
     …  it regards music as fundamental a category as speech
     …  Some even argue that speech evolved from music.
     …  music is best defined by example /16-02-11

    the science that lets us understand it
     …  quasars beggar all metaphor
     …  all the fires of the sun, from its birth to its death, would be a few weeks’ worth of work to one of them? No human sense can be made from so inhuman a scale.
     …  The current International Celestial Reference Frame uses 3,000 quasars to define the axes against which all other measurements – of the Earth’s position, of satellites, and of everything else – are made.
     …  a precision of ten microarcseconds
     …  the wonder, like the quasar, is part and parcel of the human world. /16-02-09

    Butterflies
     …  kalligrammatid lacewings, and they were doing butterflies before butterflies even were a thing. Their resemblance is a coincidence, an extraordinary example of convergent evolution
     …  appeared around 165 million years ago, during the Jurassic period, and died out 45 million years later /16-02-09

    Museums display perfect reproductions of fragile works and visitors can’t tell the difference. Is nothing in art sacred?
     …  museums have been tasked with preserving and protecting our treasures
     …  Fakes, forgeries or copies have no place in museums
     …  cult of adulation for the unique work of art
     …  We want an authentic encounter
     …  art-lovers build trips
     …  never mind that an artwork might be the product of many hands, created in the studio system
     …  Visitors expect a reverberant experience when confronting an original masterpiece.
     …  a communion with history, a sense of time-travel,
     …  celebrity
     …  Dürer’s marvellous watercolours, Young Hare and Tuft of Grass, are shown to the public only for three-month periods every few years.
     …  Today’s printing technologies
     …  In an intentionally shadowy alcove
     …  ‘after Rembrandt’, ‘school of Rembrandt’, ‘attributed to Rembrandt’, ‘circle of Rembrandt’
     …  The cardinal rule is: do not mislead the public.
     …  Modern restorations are intentionally visually distinct from the original
     …  display reproductions without making it clear
     …  Van Eyck’s Adoration of the Mystic Lamb (1432), they prepared a 100 billion-pixel digital version
     …  normal light, X-ray, infrared and UV
     …  permitted me to see the work in a way I never had
     …  reproduction offering more
     …  ‘Authenticity is an important concept but how far do we go?’
     …  Caverne du Pont d’Arc
     …  This new cave simulacrum
     …  Factum Arte
     …  The bottom line is: do not knowingly mislead.
     …  ‘Relievo Collection’
     …  Albertina’s website, I found no notice that some of the famous graphic works on display were reproductions.
     …  a digital supermuseum, with billion-pixel, multispectral images of as many masterpieces as possible (the Google Art Project /16-02-06

    soft, cuddly robots of the future
     …  inspired by flexible creatures such as octopuses, caterpillars or fish
     …  Instead of requiring intensive (and often imperfect) computations, soft robots built of mostly pliable or elastic materials can just mould themselves to their surroundings.
     …  touch people more safely
     …  what Darwinian evolution
     …  fundamentally new classes of machines
     …  Think about how hard it is to tie shoelaces
     …  Stretchable sensors can be as sensitive as skin /Nature/16-02-04

    Europe, Thomas Piketty
     …  The far right
     …  a single currency with nineteen different public debts
     …  financial markets are completely free to speculate
     …  Only a genuine social and democratic refounding of the eurozone
     …  develop their own new political institutions
     …  the United Kingdom and Poland
     …  European Stability Mechanism
     …  conference of eurozone nations on debt
     …  new form of democratic governance
     …  common corporate tax would make it possible to finance investments in infrastructure and in universities
     …  innovation and young people
     …  the finest model of social welfare on earth
     …  make the eurozone work for the common good /16-02-04

    Against Multiple Regression Analysis
     …  A huge range of science projects are done with multiple regression analysis. The results are often somewhere between meaningless and quite damaging.
     …  The correlational—the observational—evidence tells you one thing, the experimental evidence tells you something completely different.
     …  the guy who’s taking Vitamin E is also doing everything else right.
     …  enormously more deaths per million drivers who drive Ford F150 pickups than for people who drive Volvo
     …  who is more likely to be driving the pickup
     …  You know virtually nothing about the relative safety of cars based on that study. /16-02-01

    Licence to edit genes in human embryos
     …  Scientists in London have been granted permission
     …  The genetic modifications could help researchers to develop treatments for infertility, but will not themselves form the basis of a therapy.
     …  This step in the UK will stimulate debate on legal regulation of germline gene editing /16-02-01

    schizophrenia with dramatic genetic discovery
     …  new genetic pathway probably reveals what goes wrong neurologically in a young person
     …  the most significant mechanistic study about schizophrenia ever
     …  In patients with schizophrenia, a variation in a single position in the DNA sequence marks too many synapses for removal and that pruning goes out of control. The result is an abnormal loss of gray matter.
     …  C4 was "a dark corner of the human genome," he said, an area difficult to decipher because of its "astonishing level" of diversity. /16-02-01

    Nie każdy chce się z tym pogodzić, ludzie chcą mieć nadzieję, że „niebieska parcela”, reinkarnacja, nowa energia etc. Tyle walki o każdy dzień i potem nic? Tego ludzkość nie lubi. I ja to nawet rozumiem. /Ewa Lipska, Gazeta Wyborcza 30.01/16-01-31

    Consciousness may be the product of carefully balanced chaos
     …  In a new study of how anesthetic drugs affect the brain, researchers suggest that our experience of reality is the product of a delicate balance of connectivity between neurons—too much or too little and consciousness slips away.
     …  Consciousness ascribes meaning to the pattern of photons hitting your retina, thus differentiating you from a digital camera. Although the brain still receives these data when we lose consciousness, no coherent sense of reality can be assembled.
     …  brain activity varies widely between conscious and unconscious states
     …  optimal level of connectivity between neurons that creates the maximum number of possible pathways.
     …  consciousness might emerge from a careful balancing that causes the brain to “explore” the maximum number of unique pathways to generate meaning
     …  “If you’re in a critical point, the brain is really chaotic,” Boly says. “If you’re far from there, it’s too monotonous or stable.” /16-01-30

    Brain Maps Time
     …  our thoughts may take place on a mental space-time canvas
     …  the hippocampus and the entorhinal cortex, both famous for their role in memory and navigation — can also act as a sort of timer.
     …  cells aren’t tuned only to space but are capable of encoding any relevant property: time, smell or even taste.
     …  Are there dedicated neurons in the brain doing nothing else but keeping track of time? /16-01-30

    Go—a 2,500-year-old game that’s exponentially more complex than chess
     …  machine-versus-man
     …  AI system went undefeated in five games
     …  deep learning
     …  vast collection of Go moves from expert players—about 30 million
     …  system against itself .. to generate a new collection of moves
     …  Monte Carlo tree search
     …  graphics processing units
     … 
     …  That includes war or business or [financial] trading.
     …  What if the universe is just a giant game of Go? /16-01-30

    West vs. East
     …  the West is quite so alarmed at what is happening in the East
     …  Hungary and Poland – and Slovakia to a lesser degree – have discovered the magic of the conservative, authoritarian state and are moving to restrict the independence of the media and the judiciary.
     …  How to let Poland know that rules must be followed without shoving the country into a corner?
     …  What is happening in Warsaw is big trouble. /16-01-29

    American politics has taken a dangerous turn
     …  Mr Trump
     …  The 50:50 nation
     …  America, what on earth is going on? /16-01-29

    our thinking about evolution
     …  evolutionary function
     …  different forms of purpose
     …  human behaviour is not a ragbag of disconnected behaviour patterns with separate evolutionary histories. What evolves is an emotional constitution which shapes our lives as a whole. We have to explain particular actions by finding their place in it.
     …  they still believe that, behind this screen, there lie hidden the real causes, elements of evolutionary advantage
     …  group-selection
     …  deriving all our motivation from the single stem of “selfishness” – enlightened self-interest – is, says Darwin, radically mistaken.
     …  The resulting mythology of selfishness suited the Thatcherite age
     …  genes themselves were not actually solitary but highly co-operative
     …  simple atomistic pattern was neither workable nor necessary
     …  natural selection can perfectly well take place at a number of different levels
     …  The past half-century was the age of reductionism
     …  Now we are entering the age of holism
     …  superorganism
     …  group-selection is particularly plausible in the case of humans because of the invention of speech
     …  subjective phenomenon as a serious influence in the world
     …  the constant flow of inner activity by which we respond to the life around us – also affect the world
     …  Life for us is not just the absence of death.
     …  a grave objection to the sociobiological insistence that everything has an evolutionary function
     …  an evolutionary advantage behind every human taste – including, say, the taste for doing mathematics
     …  are done for their own sake because they fulfil our nature
     …  teleology is obsolete
     …  to say that feet are organs for walking on is only to say that that this is what they do
     …  pre-existing direction
     …  among many scientists is the seemingly more sceptical view that the cosmos is meaningless
     …  Richard Dawkins
     …  Nature /16-01-25

    domesticated animals escape and evolve
     …  mobile molecular-biology lab
     …  chickens of Kauai are evolving into something quite different from their wild predecessors
     …  reflect that past, but maintaining others that had been selected by humans
     …  homogeneity suggests that a gene has surged through the population in the recent past, probably because it offers some benefit.
     …  If feralization were domestication played backwards
     …  brains of domestic chickens are smaller than those of junglefowl /Nature/16-01-25

    Using techniques from evolutionary biology, scientists have traced folk stories back to the Bronze Age.
     …  relationships between versions of a story using the same tools that evolutionary biologists use to study species
     …  the last common ancestor of a group of stories
     …  Faust to blues lore, but the most ancient version, involving the blacksmith, comes from the Bronze Age!
     …  older than Christianity
     …  Despite being fictitious, they work as simulations of reality /16-01-23

    Memory capacity of brain is 10 times more
     …  petabyte range
     …  two synapses from the axon of one neuron
     …  how the brain is so energy efficient
     …  help engineers build computers
     …  the design principle for how hippocampal neurons function with low energy but high computation power.
     …  brain tissue down to a nanomolecular level.
     …  there are actually 26 discrete sizes that can change over a span of a few minutes
     …  how much information could potentially be stored in synaptic connections.
     …  26 sizes of synapses correspond to about 4.7 “bits” of information. Previously, it was thought that the brain was capable of just one to two bits for short and long memory storage in the hippocampus.
     …  Using probabilistic transmission turns out to be as accurate and require much less energy for both computers and brains /Kurzweil/16-01-23

    Accommodationism
     …  Science, Religion and the Nature(s) of Human Inquiry
     …  Faith vs Fact
     …  accommodationists usually are atheists, because a religious person who accepts scientific findings (as opposed to, say, a fundamentalist creationist) is just that, a religious person who accepts science
     …  The most famous .. accommodationists was Stephen Jay Gould.
     …  anti-accommodationists, like Richard Dawkins
     …  NOMA
     …  religious stories are best interpreted as allegories
     …  not seeking funding from the Templeton Foundation.
     …  more general belief in some sort of transcendental (i.e., non-material) entity.
     …  There is no logical contradiction between accepting all the findings of modern science and believing in a transcendental reality.
     …  a personal God who is involved in history.
     …  God as working through the laws of nature
     …  incompatibility arises from the radically different methods used by science and religion
     …  To even talk of a “method” used by religion to seek knowledge is an obvious category mistake.
     …  some “religious” claims are eminently falsifiable, and have, in fact, been falsified. /16-01-21

    Consciousness doesn’t happen. It’s a mistaken construct.
     …  These days it’s not hard to understand how the brain can process information about the world,
     …  How do we get the inner feeling?
     …  awareness, phenomenology, qualia, experience. It seems non-physical, ethereal,
     …  quantum states of microscopic tubules inside the neurons
     …  independent of the brain altogether, as many mystics claim.
     …  The brain constructs inaccurate models of the world.
     …  The consciousness we describe is non-physical, confusing, irreducible, and unexplainable, because that packet of information in the brain is incoherent.
     …  act of a massive computer. The brain also describes this act to itself. That description, shaped by millions of years of evolution
     …  Artificial consciousness may just be a hard problem within our grasp. /16-01-15

    Never Vote for Donald Trump
     …  Trump is precisely the kind of man our system of government was designed to avoid
     …  a demagogic figure who does not view himself as part of our constitutional system but rather as an alternative to it. /16-01-15

    How We Learn Fairness
     …  monkeys hate being disadvantaged
     …  disadvantageous-inequity aversion
     …  instinctual aversion to getting less than others
     …  babies as young as twelve months prefer fair-minded cartoon animals to unfair ones
     …  Unlike other animals, we sometimes balk at receiving more than other people.
     …  The question for psychologists is whether our aversion to benefitting from inequality is innate, .. some form of socialization.
     …  The absolute number of candies matters less than my relative status.
     …  for older kids who are transitioning into adolescence, status doesn’t always come from having more.
     …  What factors in society could create a norm whereby it’s valuable to establish yourself publicly as someone who doesn’t want to receive more than others?
     …  Our ideas about fairness are relativistic, rather than absolute.
     …  fairness as a form of social signalling.
     …  People tend not to care about equality as an abstract principle; instead, they use fairness to negotiate their place in a social hierarchy. /16-01-13

    key to climate action
     …  In 1992, the Catholic Church formally acknowledged that Galileo was right — Earth really does move around the Sun.
     …  COP21 .. Paris a “now or never” opportunity
     …  Pope's already famous encyclical letter of May 2015
     …  If science and religion are beginning to walk together, the devil remains in the politics. /Nature/16-01-04

    2015

    in developed countries about 75% of an individual’s lifetime medical costs
     …  are spent in the last six months of life. This is clearly money wasted.
     …  We are wired by evolution to fear death
     …  extra life is often bought at the cost of gruesome treatment, such as chemotherapy
     …  chances of dementia
     …  the doctors of the future will be able to provide patients with better and more realistic predictions .. will be more honest.
     …  health-care costs are escalating beyond the rate of inflation, which is not sustainable.
     …  denial of the inevitability of death.
     …  not how to live a long life, but how to live a good life, and how to end it with a good death. /15-12-26

    Basic Income Guarantee (BIG)
     …  The Finns are considering .. the Swiss, .. giving everyone enough money to survive.
     …  Last seriously proposed by Richard Nixon in 1969,
     …  the salvation of capitalism.
     …  modern capitalism’s most fundamental problem, lack of demand.
     …  Technology and capitalism have largely solved the problem of supply.
     …  more stuff, with fewer inputs
     …  we have more capital than we need.
     …  more and more of us replaceable by robots, software or much cheaper foreign workers.
     …  a robot can make an iPhone, it cannot buy one.
     …  post-work future.
     …  Basic Income Guarantee will be as fiscally stimulative as World War II
     …  is that it sounds too good to be true.
     …  Fear of scarcity is built into our DNA.
     …  money is something humans create, not something with fixed and limited supply.
     …  Adam Smith .. we humans are motivated primarily by the regard of others.
     …  But the very rich don’t fear unemployment, /15-12-26

    Did historical Jesus really exist?
     …  There are clearly good reasons to doubt Jesus’ historical existence.
     …  a man called Jesus of Nazareth
     …  “Historical Jesus”
     …  among atheists
     …  the lack of early sources. The earliest sources only reference the clearly fictional Christ of Faith.
     …  criterion of embarrassment
     …  sources clearly are not independent.
     …  There are no existing eyewitness or contemporary accounts of Jesus.
     …  So what do the mainstream (and non-Christian) scholars say about all this? Surprisingly very little /15-12-25

    our Universe is part of a multiverse
     …  Is string theory science?
     …  philosophy for help
     …  “if a theory is sufficiently elegant and explanatory, it need not be tested experimentally”
     …  many universes — most of which would be radically different from our own.
     …  “Suggestions that we need ‘new methods’ have been made, but attempts to replace empirical testability have always failed.” /Nature/15-12-23

    Myths that persist
     …  Vaccines cause autism - Although there are some risks associated with vaccines, the connection to neurological disorders has been debunked many times over.
     …  Paracetamol (acetaminophen) works through known mechanisms - Although it is widely used, there are only hints as to how it and other common drugs actually work.
     …  The brain is walled off from the immune system - The brain has its own immune cells, and a lymphatic system that connects the brain to the body's immune system has recently been discovered
     …  Homeopathy works. - It doesn't. /Nature/15-12-22

    developed gigantic brains
     …  less obvious but equally important advantage: a peculiar sleep pattern.
     …  humans sleep just seven hours or so a day — “the least of any primate on the planet,”
     …  22 percent of sleep in REM, the highest ratio of REM to total sleep in any primate
     …  REM .. it consolidates new memories into lasting impressions.
     …  monkey .. slept on branches, and their nights were anything but easy.
     …  Homo erectus slept on the ground /15-12-22

    String theory, the multiverse and other ideas of modern physics are potentially untestable.
     …  meeting in Munich
     …  “need philosophers and historians of science like birds need ornithologists”
     …  “battle for the heart and soul of physics.”
     …  George Ellis and Joe Silk
     …  dangerous departure from the scientific method.
     …  “The imprimatur of science should be awarded only to a theory that is testable”
     …  String Theory and the Scientific Method identified three kinds of “non-empirical” evidence
     …  “fact of nature”
     …  Whether the fault lies with theorists for getting carried away, or with nature, for burying its best secrets, the conclusion is the same: Theory has detached itself from experiment.
     …  “Physicists, philosophers and other scientists should hammer out a new narrative for the scientific method that can deal with the scope of modern physics.”
     …  “is not one of ideology but strategy: What is the most useful way of doing science?”
     …  theory, confirmation, truth
     …  Karl Popper’s rule of thumb
     …  “not even wrong”
     …  falsificationism is no longer the reigning philosophy of science.
     …  Bayesian confirmation theory .. “.. connects nicely to the psychology of reasoning.”
     …  “string theory is the only game in town,”
     …  “unexpected explanatory interconnections,” as Dawid has termed them
     …  Polchinski also used Dawid’s non-empirical arguments to calculate the Bayesian odds that the multiverse exists as 94 percent
     …  “Popper was not a naive Popperian,”
     …  “Dawid’s idea of non-empirical confirmation [forms] an obstacle to this possibility of progress, because it bases our credence on our own previous credences.”
     …  “Keep speculating,”
     …  “give your motivation for speculating, give your explanations, but admit that they are only possible explanations.”
     …  We may never know for sure the way the universe works /15-12-20

    triumph of mathematicians over philosophers
     …  The moment it was accepted that Aristotle had not been right about everything was a crucial turning point in the history of science.
     …  still in some populist quarters described as a triumph of experimental reason over religious superstition.
     …  Newtonianism would have been inconceivable without the tradition of belief in a creator God.
     …  numbers and experiments, against philosophers
     …  Eisenstein thesis
     …  a linguistic argument
     …  Before Columbus discovered the Americas, he argues, the idea of “discovery” literally did not exist.
     …  William Shakespeare had “no sense of history”
     …  very few people are still so “relativist” that they believe that scientific knowledge is nothing but socially constructed and that it is therefore impossible to say that quantum physics is superior to the theory of the four bodily humours. /15-12-17

    abc conjecture
     …  a + b = c and connects the prime numbers that are factors of a and b with those that are factors of c.
     …  Mochizuki’s papers, which totalled more than 500 pages
     …  exceedingly abstract and cryptic even by the standards of pure mathematics
     …  Mathematical theatre
     …  “The claim is an extremely important result,” .. and the community deserves to know whether it is valid /Nature/15-12-16

    ultramarathoners are driven by something more secular than spirituality—they could be hungry for meaning.
     …  to run three thousand miles around a single city block.
     …  The route isn’t picturesque or awe-inspiring;
     …  they aren’t just driven by personal glory.
     …  unners who want to test themselves,
     …  race for a sense of harmony and balance.
     …  athleticism was an aspect of the road to enlightenment.
     …  he runs to train his mind
     …  “Even as I’m suffering, I recognize that I’m lucky to be putting this on myself voluntarily.”
     …  feeling guided by something larger than myself.
     …  meaningfulness, the sense that one’s life has broad value and purpose.
     …  distinction between happiness and meaningfulness.
     …  grander rewards in the distant future.
     …  feedback loop
     …  to set and achieve goals—even arbitrary ones.
     …  In the developed world, many of us spend the vast majority of our lives in a comfortable equilibrium. /15-12-16

    Paradox at the heart of mathematics makes physics problem unanswerable
     …  Gödel’s incompleteness
     …  impossible to calculate an important property of a material — the gaps between the lowest energy levels of its electrons
     …  “genuinely shocking, and probably a big surprise for almost everybody working on condensed-matter theory”
     …  From logic to physics
     …  “Turing thought more clearly about the relationship between physics and logic than Gödel did”
     …  for an infinite lattice, it is impossible to know whether the computation ends, so that the question of whether the gap exists remains undecidable.
     …  The problem is that there is no rigorous mathematical theory which explains why the force-carriers have mass, when photons, the carriers of the electromagnetic force, are massless.
     …  methods and ideas will show that the Yang–Mills mass-gap problem is undecidable. /Nature/15-12-15

    decarbonization at the Paris climate conference
     …  Even religious leaders have spoken mightily of the dangers of unchecked climate change.
     …  to cut deforestation
     …  Shifting whole industries into more sustainable modes
     …  widely discussed goals such as stopping warming at 2 °C above preindustrial levels. The better metric is whether Paris engages a growing share of industry and governments in the climate task. When the meetings in Paris are done, the real business of decarbonization must begin. /Nature/15-12-15

    Signal and Noise at the Paris Climate Summit
     …  the signal, at its core, says that “the transition to cleaner, low-emissions energy sources is necessary, inevitable, irreversible, and beneficial.”
     …  Batteries, buildings, electric vehicles, and mass-transit systems
     …  whoever continues doing business as usual will wither.
     …  I.N.D.C.s, or intended nationally determined contributions,
     …  denying or ignoring climate change is gone.
     …  will it catalyze billions of dollars of investment,
     …  implementing penalties on CO2 pollution /15-12-14

    Words can be inspiring, even when .. seem deep but say nothing
     …  "wholeness quiets infinite phenomena." It's complete and utter nonsense. In fact, it was randomly generated
     …  nearly 300 hundred participants to rate the profundity of randomly generated sentences
     …  they considered them to be profound or even very profound.
     …  proliferation and effectiveness of bull /15-12-07

    How exactly did consciousness become a problem?
     …  Descartes and Locke considered conscious experience as something that couldn’t be wholly explained by the laws of physical nature.
     …  If consciousness is a secondary byproduct of physical laws, .. – then consciousness becomes truly irrelevant.
     …  the neuroscientists who, with increasing frequency, are proposing theories for how subjective experience might emerge from a matrix of neurons and brain chemistry.
     …  why is consciousness perceived as a ‘problem’?
     …  Heaven was often portrayed in a gorgeous shade of blue, achieved through costly pigments containing ground lapis lazuli
     …  Blue, here, was the wavelength of God.
     …  The baby of personal experience and conscious moral accountability was thrown out with the bathwater of the soul
     …  Descartes wanted to preserve the essence of medieval dualism while simultaneously opening up a space for mathematical science.
     …  art has come to represent the power of the individual perspective
     …  literature .. to become immersed in other people’s minds.
     …  Max Tegmark .. consciousness will turn out to be another state of matter
     …  the essence of subjectivity
     …  ‘that consciousness is existentially primary’ /15-12-07

    Wszystko, co istnieje w poznanym dotychczas świecie, zbudowane jest z tych samych elementów fizycznych – atomów – wspólnych dla organizmów żywych i materii nieożywionej. Teza o powstaniu zjawiska życia poprzez jednorazowy akt twórczy nie jest akceptowana przez fizykę. Sądzimy, że życie od około 4 miliardów lat rozwijało się z atomów poprzez formowanie, a następnie przez interakcje prostych cząsteczek chemicznych i makrocząsteczek. W procesie ewolucji powstawało coraz więcej „części”, a relacje między nimi stawały się coraz bardziej złożone. W wyniku tych procesów powstały złożone systemy biologiczne.
    Organizmy żywe są zorganizowane według hierarchicznego porządku. Idąc „od dołu”, czyli od najniższego poziomu, możemy odczytać następujący porządek hierarchiczny żywych organizmów wielokomórkowych: siły i cząstki subatomowe -> atomy -> cząsteczki chemiczne -> sieci molekularne -> komórki -> narządy -> organizmy -> populacje organizmów -> ekosystemy. Wyższy poziom ogranicza i „zniewala” poziom niższy. Wyższe poziomy hierarchicznego porządku mają nowe emergentne struktury i funkcje niewystępujące na poziomie niższym, dlatego też wyższe poziomy systemów złożonych nie mogą być w pełni redukowalne do poziomów niższych i ich części. Właściwości wyższych poziomów w systemach złożonych nie są w pełni przewidywalne, dlatego np. właściwości fenotypowe nie mogą być bezkrytycznie dedukowane na podstawie właściwości genotypowych.
    Biologia ostatniego półwiecza interesowała się zasadniczo kwestią, z jakich cząsteczek chemicznych zbudowana jest komórka jako podstawowy element żywy, co po odkryciu struktury i funkcji DNA przed 62 laty doprowadziło do genocentryzmu, a następnie sprzyjało formułowaniu często bardzo uproszczonych poglądów na fenomen życia, na formę i funkcję żywych organizmów, w tym także człowieka. Paradoksalnie, badając fenomen życia metodą redukcjonistyczną, w pierwszej kolejności najczęściej niszczymy zjawisko życia, bo zabijamy komórki, rozcierając je na homogenną masę.
    Sądzono, że pełna analiza sekwencji ludzkiego DNA (Human Genome Project) pozwoli odkryć geny, które są przyczyną chorób, co z kolei ułatwi diagnostykę i leczenie. Okazało się jednak, że tylko w niewielu chorobach można prześledzić prosty, przyczynowy związek z pojedynczym genem. Większość chorób ma przyczynę wieloczynnikową, a w ich patogenezie mają swój udział liczne uszkodzenia genetyczne, molekularne zaburzenia regulacyjne, środowisko, czynniki epigenetyczne itd.
    Gromadzenie wiedzy o złożoności i hierarchicznej organizacji organizmów żywych, o zjawisku emergencji i roli interakcji cząsteczek chemicznych na podstawowym poziomie hierarchicznym, oraz konieczność szerszego i całościowego spojrzenia na zjawisko życia znalazły wyraz w powstaniu nowego działu biologii – biologii systemów. Biologia systemów twierdzi, że istota życia nie tkwi ani w cząsteczkach DNA, ani w białkach lub w innych makromolekułach, lecz we współdziałaniu oraz interakcji między nimi. Systemy, w których przebiegają wszelkie procesy biologiczne, są dynamiczne, plastyczne, wykazują oporność, ale i zdolności adaptacyjne, są wieloskalowe. Systemy biologiczne są zdolne do przechowywania i przekształcania informacji. Wraz ze wzrostem złożoności pojawiają się nowe struktury i właściwości zwane emergentami, których nie ma w częściach układu. Złożoność nie jest prostym sumowaniem części, a interakcje między nimi nie są liniowe – to znaczy, że między przyczyną a skutkiem nie ma zależności proporcjonalnej. Relacje między składnikami systemu opisywane są przez złożone algorytmy, są zwykle cykliczne i obfitują w sprzężenia zwrotne i redundantne kontrole dające odpór presji środowiska. Kanoniczna reguła wynikająca z podejścia redukcjonistycznego głosi, że przyczynowość sprawcza biegnie w kierunku „dół -> góra”, to znaczy od poziomu bazalnego (gdzie „dokonuje się cała praca”) do poziomów wyższych. Przyczynowość sprawcza działa również w kierunku „góra -> dół”, a także w obrębie samych poziomów hierarchicznych.
    Nauka, w ostatnich paru dekadach, przypisuje zasadnicze znaczenie zjawisku samoorganizacji jako podstawowemu procesowi w powstaniu i ewolucji życia. Samoorganizacja występuje na różnych poziomach hierarchicznych i jest uważana za podstawowy czynnik w powstawaniu złożoności. Zjawisko samoorganizacji, powszechne w przyrodzie (np. skomplikowane struktury w komórce, insekty socjalne, ławice ryb itp.), jest badane i wykorzystywane w praktyce (nanotechnologie) przez człowieka. W tych przykładowych systemach nie działa żaden centralny czynnik lub ośrodek sterujący. Ośrodki takie są liczne, rozproszone po układzie, a ich działanie ujawnia się skoro tylko system znajdzie się w odpowiednich warunkach. Proces samoorganizacji zachodzi bez instrukcji od bodźca zewnętrznego i bez odniesienia do globalnego wzoru. Na poziomie molekularnym są to cząsteczki chemiczne, które oddziaływają między sobą poprzez słabe wiązania chemiczne. Samoorganizacja jest spontanicznym tworzeniem ogólnego, spójnego porządku, który wyłania się (emergencja) z lokalnych informacji i interakcji między komponentami niższego poziomu. Samoorganizacja generuje niezwykłą kreatywność przyrody.
    Na poziomie cząsteczkowym system biologiczny przedstawia niezwykle złożoną sieć, której strukturę i zależności funkcjonalne najlepiej ilustrują grafy. Wieloletnie badania z użyciem wielu wyrafinowanych metod pozwoliły na poznanie interakcji między tysiącami biologicznych cząsteczek i makrocząsteczek i zbudowanie ogromnych baz danych. Najwcześniejsze dane i pierwowzory sieci uzyskano w wyniku badań nad reakcjami metabolicznymi w organizmach żywych.
    Do znalezienia praw i reguł rządzących takimi złożonymi systemami włączono różne nauki, zwłaszcza matematykę, bioinformatykę oraz komputery wielkiej wydajności. Budowane są modele ilustrujące strukturę i funkcję sieci w rozmaitych warunkach. Modele te są następnie sprawdzane doświadczalnie. Obecnie poznane są już pewne prawidłowości w strukturze sieci, poznano podsieci oraz struktury i funkcje najczęściej spotykanych motywów, które spełniają podstawowe funkcje kontrolne.
    Przed biologią stoi wielkie wyzwanie poznania złożoności zjawiska życia. Tymczasem w polskich programach studiów biologicznych i medycznych na zjawisko życia patrzy się stale jeszcze w sposób zawężony, a czasami bardzo uproszczony. Sądzę, że już najwyższy czas, by w programach nauczania znalazło się miejsce na dyskusję o elementach biologii systemów.
    Dobrze się stało, że Wydział Matematyki Uniwersytetu Warszawskiego podjął się trudu zorganizowania zaawansowanych studiów stacjonarnych w zakresie bioinformatyki i biologii systemów. Pozwoli to na zasilenie naszych ośrodków naukowych badaczami, którzy zmierzą się w przyszłości z podstawowymi problemami nowego rozdziału w biologii.
    /Mieczysław Chorąży/PAUza nr 313/15-11-26

    Nicolaus Copernicus is famous
     …  Albert Einstein, with his
     …  The ability for seemingly constant things to evolve and change is an important aspect of Einstein’s legacy. If space and time can change, little else is sacred.
     …  a multiverse in which the very laws of physics themselves can change from place to place and time to time.
     …  We currently have no direct evidence that there is a multiverse, of course. But the possibility is very much in the spirit of Einstein’s reformulation of spacetime, or, for that matter, Copernicus’s new theory of the Solar System. Our universe isn’t built on unmovable foundations; /Sean Carroll/15-11-25

    Agriculture Linked to DNA Changes
     …  after agriculture arrived in Europe 8,500 years ago, people’s DNA underwent widespread changes
     …  indirect clues .. by studying the genomes of living Europeans
     …  we have a time machine
     …  ancestors adapted to agriculture through natural selection
     …  DNA of Europeans today comes from three main sources.
     …  genomes of 230 people who lived between 8,500 and 2,300 years ago
     …  light skin helped capture more vitamin D in sunlight at high latitudes
     …  the shift to agriculture, which reduced the intake of vitamin D, that may have triggered a change in skin color
     …  One day, they may be able to track historic changes in the human genome across the globe over tens of thousands of years. /15-11-24

    making things matters less and knowing things more
     …  internet of things (IoT)
     …  a “platform”, a layer of software that combines different kinds of devices
     …  A high-end car, has the digital horsepower of 20 personal computers and generates 25 gigabytes of data per hour of driving
     …  Apple and Google are pressing carmakers to install the operating systems
     …  German carmakers
     …  Plattform-Kapitalismus .. Google and Facebook
     …  user interfaces for German products are .. so complex /15-11-19

    Ctrl+X for disease and Ctrl+V for talent
     …  Imagine if living things were as easy to modify as computer software.
     …  Such a vision might either excite or horrify, depending on your point of view.
     …  gene editing is based on a natural process.
     …  to ‘improve’ a person’s genetic make-up? Practically speaking, there’s no reason why not.
     …  improving our cognitive powers, or increasing our life expectancy, /15-11-15

    Relativity and quantum mechanics are fundamentally different theories
     …  a quantum of space
     …  nothing less than a third revolution in modern physics
     …  It could tell us where the laws of nature came from, and whether the cosmos is built on uncertainty or whether it is fundamentally deterministic
     …  meaningless to ask how gravity behaves at distances smaller than a single chunk of space
     …  strings are drastically smaller even than the spatial structures Hogan is trying to find
     …  space itself might emerge from .. only two dimensions
     …  to build a device that could measure the exceedingly fine graininess of space
     …  Holometer
     …  1e-18 m
     …  A success for the holometer would mean failure for .. string theory.
     …  the primacy of quantum mechanics runs deeper still
     …  General relativity is not a description of subsystems. It is a description of the whole universe as a closed system.
     …  Smolin’s principle of precedence
     …  big-small debate
     …  We don’t even know what time is. /15-11-10

    manipulate our DNA more easily
     …  Feng Zhang
     …  CRISPR
     …  Inevitably, the technology will also permit scientists to correct genetic flaws in human embryos.
     …  eventually be passed down to children, grandchildren
     …  that scientists will be able to rewrite the fundamental code of life, with consequences for future generations that we may never be able to anticipate.
     …  grand unified theory of genetics
     …  CRISPR is the Model T of genetics
     …  The brain is still the place in the universe with the most unanswered questions.
     …  Addgene .. a nonprofit repository that houses tens of thousands of ready-made sequences
     …  there was a reductionist approach to genetics
     …  created a mouse that was easy to edit .. Cas9 mouse
     …  that every cancer is a specific, personal disease
     …  Nobody is going to employ CRISPR technology to design a baby, let alone transform the genetic profile of humanity, anytime soon.
     …  Modern medicine already shapes our genome, .. edited out of our genome by natural selection.
     …  Today, though, with more than five million children on earth born through in-vitro fertilization,
     …  it is essential to assess both the risks and the benefits of any new technology
     …  If CRISPR helps unravel the mysteries of autism, contributes to a cure for a form of cancer, or makes it easier for farmers to grow more nutritious food while reducing environmental damage, the fears, like the many others before them, will almost certainly disappear. /15-11-10

    BITCOIN has a bad reputation.
     …  This is unfair.
     …  European Union recently recognised it as a currency
     …  it is a machine for creating trust.
     …  The blockchain .. In essence it is a shared, trusted, public ledger that everyone can inspect, but which no single user controls.
     …  It is what makes possible a currency without a central bank.
     …  Blockchains are also the latest example of the unexpected fruits of cryptography.
     …  Financial-services firms are contemplating using blockchains as a record of who owns what
     …  to create more scrutiny and transparency could be no bad thing.
     …  to transform how people and businesses co-operate.
     …  digital currency beyond the reach of any central bank.
     …  The real innovation is not the digital coins themselves, but the trust machine that mints them—and which promises much more besides. /15-11-03

    redesigning the basic building block of capitalism
     …  Uber
     …  Airbnb
     …  they are also reinventing what it is to be a company.
     …  and each layer has its own interests to serve and rents to extract.
     …  producing good short-term results, quarter after quarter.
     …  short-termism
     …  Family companies have a new lease of life.
     …  high-potential startups that go by exotic names such as unicorns and gazelles.
     …  young people are creating new firms in temporary office spaces, fuelled by coffee and dreams.
     …  The central difference lies in ownership
     …  new technology
     …  crowdsourcing sites such as Kickstarter
     …  programmers from Upwork
     …  rent computer-processing power from Amazon
     …  ordinary people can invest in startups directly through platforms such as SeedInvest /15-10-24

    Fragment of rat brain simulated in supercomputer
     …  The complexity of the model far outstrips the simplicity of what is being captured
     …  Simulating the human brain, he says, poses huge computational challenges: whereas the rat-cortex simulation runs a billion calculations every 25 microseconds, a human simulation would require a billion times more than that. /15-10-13

    Price carbon
     …  cutting global carbon emissions.
     …  Climate change is a serious challenge
     …  I will if you will
     …  A global carbon price
     …  in the Alps, villagers have successfully managed shared land for hundreds of years, /15-10-13

    mathematics
     …  impenetrable proof

     …  Shinichi Mochizuki
     …  The trouble that he faces in communicating his abstract work to his own discipline mirrors the challenge that mathematicians as a whole often face in communicating their craft to the wider world.
     …  The abc conjecture
     …  Looking at it, you feel a bit like you might be reading a paper from the future.
     …  Edge of reason
     …  I do think, based on my knowledge of Mochizuki, that the likelihood that there's interesting or important math in those documents is pretty high /15-10-13

    imprecise supercomputers
     …  Energy-optimized hybrid computers with a range of processor accuracies will advance modelling in fields from climate change to neuroscience
     …  computers would consume about 100 megawatts — the output of a small power station
     …  Inexact hybrid computing has the potential to aid modelling of any complex nonlinear multiscale system
     …  energy-efficient hybrid computing is indispensable for modelling the brain, and hence for understanding cognition.
     …  human creativity arises from a close synergy between low-energy computation (in which the operation of the brain is susceptible to the brain's own thermal noise) and higher-energy determinism (in which the implications of partially random cognitive jumps can be explored algorithmically in localized parts of the brain)
     …  human creativity might be a by-product of evolutionary pressures to optimize the use of energy /15-10-06

    There is no known physics theory that is true at every scale—there may never be.
     …  But if we expect our theories to be complete, that means that before we can have a theory of anything, we would first have to have a theory of everything—a theory that included the effects of all elementary particles we already have discovered, plus all the particles we haven’t yet discovered! That is impractical at best, and impossible at worst.
     …  Feynman was wrong to have been disappointed with his own success in maneuvering around these infinities
     …  superstring theory .. there is not any evidence that it actually describes the universe we live in.
     …  the more we learn about string theory, the more complicated it appears to be
     …  early expectations about its universalism may have been optimistic.
     …  nature, as Feynman once speculated, could be like an onion, with a huge number of layers.
     …  new physics to discover
     …  never be a final, universal theory /Krauss/15-10-06

    see yourself in a world where only math is real
     …  what’s the time?
     …  what’s the place?
     …  a property of yourself
     …  In my book Our Mathematical Universe, I argue that not only spacetime, but indeed our entire external physical reality, is a mathematical structure, which is by definition an abstract, immutable entity existing outside of space and time.
     …  our reality is vastly larger than we thought, containing a diverse collection of universes obeying all mathematically possible laws of physics.
     …  we too are made of the same kinds of elementary particles
     …  we humans don’t yet fully understand what we are.
     …  onsciousness can one day be understood as a form of matter, a derivative of the most beautifully complex spacetime structure in our universe. /15-10-05

    wiedza o zasadach, jakimi rządzi się metoda naukowa jest w polskim społeczeństwie znikoma. Nie dowiadujemy się o niej w szkole,
     …  Nie uczymy jej na studiach,
     …  Tzw. popularyzacja nauki w prasie codziennej polega głównie na wyszukiwaniu sensacji i często przypomina propagowanie „naukowej” magii, urągając METODZIE NAUKOWEJ właśnie.
     …  chcemy dogonić świat. /Andrzej Białas/Pauza Akademicka 308/15-10-02

    surprisingly cold ‘blob’ in the North Atlantic ocean
     …  if the circulation is really slowing we need to weigh
     …  dramatic melting of Greenland, by injecting large volumes of freshwater into the ocean, may be the cause.
     …  human-caused factors
     …  All eyes now turn to the scientists doing the hard work of taking direct measurements of the circulation /15-10-01

    Sweden is shifting to a 6-hour work day
     …  We want to spend more time with our families, we want to learn new things or exercise more.
     …  less staff conflicts because people are happier
     …  Sweden - which btw is also making moves to become the world's first fossil fuel-free nation /15-10-01

    Gene-edited 'micropigs' to be sold as pets at Chinese institute
     …  more serious research
     …  an unexpected byproduct — tiny pigs
     …  micropigs as models for human disease
     …  about 15 kilograms when mature
     …  US$1,600
     …  gene editing taking biology by storm
     …  dogs or cats will be next
     …  ethicists agree that gene-edited pets are not very different from conventional breeding /15-10-01

    Kotarbiński był wprawdzie powszechnie szanowany w czasie swego długiego życia, ale bywało i odwrotnie. W 1943 roku został umieszczony na liście osób przeznaczonych do likwidacji, sporządzonej przez radykalną prawicę. Powodem był jego (umiarkowany) liberalizm lewicowy i filosemityzm. Był też ceniony w PRL, o czym świadczą stanowiska, jakie piastował, i odznaczenia, jakie mu przyznano. Kotarbiński bywał (i nadal tak jest) krytykowany za zbytnią uległość wobec władz PRL. Zupełnie niesłusznie, gdyż jego postawa współpracy wypływała z realizmu praktycznego, a nie sympatii do komunizmu. Jego ateizm i antyklerykalizm sprawiły, że kilka szkół przestało go uważać za patrona po roku 1989, ale niektóre (m.in. w Andrychowie, Dzierżoniowie, Olsztynie) oparły się tej tendencji. Biblioteka Uniwersytetu Warszawskiego ma w swym hallu cztery posągi filozofów (Twardowskiego, Tarskiego, Leśniewskiego, Łukasiewicza), ale zabrakło miejsca dla Kotarbińskiego – jak wieść niesie właśnie z powodów światopoglądowych. Kotarbiński umarł w Laskach pod Warszawą. Tuż przed jego śmiercią przystanął ksiądz przy łóżku i wyciągnął rękę do chorego. Kotarbiński ją uściskał, a duchowny ogłosił potem publicznie, że filozof w ten sposób wyspowiadał się i przyjął ostatnie sakramenty. Przytaczam te fakty nie dla sensacji, ale ku przestrodze. Oto biografia i ocena jednego z wielkich współczesnych Polaków bywają ma- nipulowane gwoli doraźnych potrzeb politycznych. Dotyczy to kogoś, kto całym swoim życiem zaświadczał o respektowania moralnych imponderabiliów. Jan Woleński, Pauza Akademicka 307/15-09-25

    Social sciences and humanities faculties 'to close' in Japan
     …  serve areas that better meet society’s needs
     …  linked to a low birth rate and falling numbers of students /15-09-25

    Pope John Paul II
     …  was a globe-trotter. He introduced the open Popemobile
     …  He was the first Pope to visit a synagogue
     …  John Paul was probably seen by more people in person than anyone in history.
     …  But John Paul probably still left a more profound impression than almost any secular politician of his era. And the new guy seems headed down the same track. /New Yorker/15-09-22

    licence to edit genes in human embryos
     …  fundamental insights into early human development
     …  CRISPR/Cas9
     …  to eradicate a genetic disease
     …  the UK could serve as a model for other countries
     …  that is not going to be implanted into a woman, and which will be destroyed after a few days of culture /15-09-21

    Homo naledi .. a mosaic species
     …  suggests that nature was experimenting with how to evolve humans, .. a shockingly teleological view
     …  If it hadn’t been for the human ego, taxonomists would long ago have squeezed all hominoids into a single genus.
     …  The problem is that we keep assuming that there is a point at which we became human.
     …  a miraculous spark — that made us radically different.
     …  We simply don’t know if Homo naledi buried corpses with care
     …  We are trying way too hard to deny that we are modified apes.
     …  Why not seize this moment to overcome our anthropocentrism
     …  /15-09-18

    Deep Learning Machine Teaches Itself Chess
     …  by evaluating the board rather than using brute force to work out every possible move.
     …  the top 2.2 percent of tournament chess players.
     …  neural network .. faster computers .. massive annotated datasets to train the networks.
     …  now routinely outperform humans in pattern recognition tasks such as face recognition
     …  randomly choosing five million positions from a database of computer chess games. .. then created greater variety by adding a random legal move to each position
     …  played against itself with the goal of improving its prediction /15-09-18

    Richard Dawkins: Brief Candle in the Dark
     …  The Selfish Gene .. genes, not organisms, were the targets of natural selection.
     …  for evolution, against design in nature,
     …  the 'new atheism', a fundamentalist sect that has mounted a scientistic crusade against all religion.
     …  Dawkins has a quantitative turn of mind, but is better at algorithms than theorems. So indeed is life itself, which is why biology has so few laws.
     …  Today's genome is much more than a script .. Many researchers continue to find selfish DNA a productive idea, but taking the longer view, the selfish gene per se is looking increasingly like a twentieth-century construct.
     …  For a time, Dawkins was a rebellious scientific rock star. Now, his critique of religion seems cranky, and his immovably genocentric universe is parochial. /15-09-18

    Letter from the Vatican .. A determined Pope Francis moves to reform a recalcitrant Curia. ... during the final years of his papacy, when, suffering from Parkinson’s disease, he was severely incapacitated, many things went wrong. ... John Paul II, a century later, with his doctrinal orthodoxy and demands of strict obedience to the Pope. ... “Every Pope is different,” he said. “Every Pope reflects his own time and is the right Pope for that particular time. And so the Church adapts. This is the secret to its survival over two thousand years, with the help of the Holy Spirit.” /Alexander Stille/15-09-14

    Bóg bez znaczenia ... oświeceniowi deiści i agnostycy, obawiający się, że utrata przez lud wiary w boga mogłaby oznaczać zwolnienie hamulców .. Helena Eilstein, jak wielu nieteistycznych, myślicieli, wskazuje, że taką postawę należy uznać za "moralnie kwestionowalną, niezależnie od tego, czy by się tak czyniło po to, by poskromić «bestię» w człowieku", czy też po to , by chronić ludzi przed rozpaczą egzystencjalną /Janusz A. Majcherek/15-09-14

    Me & my brain .. neuroscience's closet dualism ... "double-subject fallacy": treating the brain and the entire person as two independent subjects who can simultaneously occupy divergent psychological states and even have complex interactions with each other-as in "my brain knew before I did." ... the origins of such writing .. its relevance to the debate on legal and moral responsibility. /15-09-14

    Descartes' Error ... If the whole brain is doing a job for 'us', then what is left to be the basis of 'we'? ... For thousands of years, humans have been comfortable with the idea that each person's fundamental essence is something other than the body itself /15-09-14

    human intelligence and AI will co-evolve ... computers would gain human-level ability around the year 2050, and superhuman ability less than 30 years after. ... AI can be thought of as a search problem over an effectively infinite, high-dimensional landscape of possible programs. Nature solved this search problem by brute force ... genetic architecture of complex traits such as human cognitive ability. ... genomic selection of embryos ... The potential for improved human intelligence is enormous. ... IQ of over 1,000 .. it is far beyond our own. ... These two threads—smarter people and smarter machines—will inevitably intersect. ... ethical considerations. Rebooting an operating system is one thing, but what about a sentient being with memories and a sense of free will? ... huge clusters of GPUs .. have recently surpassed human performance .. image or character recognition. ... Understanding neural networks in their full generality is a problem that, like quantum foundations, tests the limits of the human mind. ... feedback loop: Better human minds invent better machine learning methods, which in turn accelerate our ability to improve human DNA ... the ordinary human (rapidly losing the ability to comprehend what is going on around them); the enhanced human ... brain interfaces .. human minds uploaded into cyberspace /15-09-07

    President Obama warned ... "Climate change is already disrupting our agriculture and ecosystems, our water and food supplies, our energy, our infrastructure, human health, human safety. Now. Today.” ... no more than 2 degrees Celsius ... “The negotiations’ goal has become what is politically possible, not what is environmentally desirable.” ... carbon pollution /15-09-07

    Cities are starting to put pedestrians and cyclists before motorists. ... Cyclists and motorists have never liked sharing the road. ... to keep petrolheads and pedalophiles apart. ... close some roads to cars on weekends. ... Amsterdam and Copenhagen are the pacesetters, with a third of trips made by bicycle. /15-09-04

    every society offers remedies for the anxiety that the fact of mortality evokes. Religions have their afterlives, while secular faiths offer continuity with some larger entity – nations, political projects, the human species, a process of cosmic evolution ... By leaving a mark, we can feel ... it might seem that the whole of human culture is an exercise in death denial. ... The Worm at the Core ... many human beings have welcomed their mortality. ... longing for everlasting life has been at its strongest in societies and individuals whose values are shaped by monotheism ... Greek polytheism .. everlasting life might be a curse – an eternity of boredom. ... It is unreasonable to look to philosophy for remedies for this quintessentially human self-division. Better take up a religion, or else accept and enjoy the short, uncertain life we are given. /John Gray/15-09-02

    How Reliable Are Psychology Studies? ... reliable proportion might be unnervingly small. ... the publication of studies that documented impossible effects like precognition, ... outright fraud ... publication bias ... p-hacking ... torture positive results out of ambiguous data. ... reproducibility crisis ... Does this mean that only a third of psychology results are “true”? ... science working as it should in being very self-critical and questioning everything, especially its own assumptions, methods, and findings. /Nosek/15-09-02

    Fearing Artificial Intelligence ... lethal autonomous weapon systems (LAWS) that will make life-and-death decisions without human intervention. ... computers will take away all the jobs that humans do, including the ones that require intelligence ... destroy or enslave humanity ... thinking, planning, linguistic expression, science, art – become automated ... Who is responsible for a lethal act committed .. human builders did not explicitly program ... towards a post-human future ... Accelerated Non-Biological Evolution ... Even machines may lose control of what greater machines may emerge rapidly through such hyper-evolution. ... machines complex enough to be intelligent will also bring with them their own suite of biases, emotions and drives. ... Even the child does not entirely inherit the parents' value system. ... very large-scale neural networks capable of generalized learning without explicit guidance /15-08-31

    Machine ethics ... Asimov .. the Three Laws of Robotics .. 1) A robot may not injure a human being or, through inaction, allow a human being to come to harm; 2) A robot must obey the orders given it by human beings, except where such orders would conflict with the First Law; and 3) A robot must protect its own existence as long as such protection does not conflict with the First or Second Laws. ... toy robot called Nao was programmed to remind people to take medicine .. nontrivial ethics questions .. how should Nao proceed if a patient refuses her medication? ... Learning algorithms then sorted through the cases until they found patterns that could guide the robot in new situations ... robot can extract useful knowledge even from ambiguous inputs ... get better at ethical decision-making as it encounters more situations ... The principles that emerge are not written into the computer code, so “you have no way of knowing why a program could come up with a particular rule telling it something is ethically 'correct' or not” ... creating programs with explicitly formulated rules, rather than asking a robot to derive its own. ... the last thing you want is to send an autonomous robot on a military mission and have it work out what ethical rules it should follow in the middle of things ... the outcomes of ethical machine programs are always knowable. ... By contrast, the machine-learning approach promises robots that can learn from experience, which could ultimately make them more flexible and useful than their more rigidly programmed counterparts. ... to combine the approaches ... Google's driverless cars ... how to program cars to both obey rules and adapt to situations /15-08-31

    virtually unassailable version of Bell's test ... the first Bell experiment that closes both the detection and the communication loopholes. ... using both light and matter. ... ingenious and beautiful experiment ... named on a Nobel prize /15-08-31

    The disconnect between religion and culture ... It is no longer possible to contrast a "secular" West with a "religious" East, ... even in Muslim countries. ... A society can consist of a majority of believers and still be secular, as in the United States. ... does not mean that people become atheists, but that they care less about religion. ... Since the 1960s, the old moral order has indeed been replaced by a new dominant culture. This culture is based on freedom, particularly sexual freedom, and materialism; ... This rise of pluralism .. is a sign of secularization. ... eviction of religion from mainstream culture. /15-08-23

    It is perhaps the most famous experiment in neuroscience .. Libet ... two pervasive intuitions we have about the mind. .. our minds are a separate thing from our physical selves – a natural dualism .. the belief that we know our own minds. /15-08-23

    fusion reactor ... running within 10 years ... MIT's new reactor .. the ARC reactor ... uses new commercially available superconductors /15-08-23

    The physicist .. explains ... Dark matter — the unseen 80 percent of the universe’s mass ... complex dark matter ... dark sector ... dark atoms and dark photons ... dark sector and our own sector — only communicate by gravity /15-08-22

    THE genome is written in an alphabet of just four letters. ... technology promises to make it possible to edit genetic information quickly and cheaply. ... correct terrible genetic defects ... parents building their children to order. ... scientists in China .. That is a Rubicon ... CRISPR’s ethics .. practical and philosophical ... side-effects ... It may take a generation to ensure that the technology is safe. Until then, couples with some genetic diseases can conceive using in-vitro fertilisation and select healthy embryos. ... humans play God. But medicine routinely intervenes ... Some might see being short or myopic as problems that need fixing. ... Deaf parents may prefer their offspring to be deaf too ... to make children smarter, should that option really be limited to the rich? /15-08-22

    College is seldom about thinking or learning anymore. ... literally anonymous bureaucracy ... education in the age of neoliberalism. ... market fundamentalism, ... to produce producers. ... Of course we provide our students with a real education ... Everybody talks about the STEM fields — science, technology, engineering, and math — but no one’s really interested in science, and no one’s really interested in math ... Modernity is a condition of ever-increasing acceleration ... Students rarely get the chance to question and reflect anymore ... Youth, now, is nothing more than a preliminary form of adulthood, ... deleting the phrase: Basic to every purpose of the system is the search for truth. .. The university’s mission would henceforth be to meet the state’s workforce needs. ... All this explains a new kind of unhappiness I sense among professors. ... the vigorous intellectual dialogue you get to have with vibrant young minds. That kind of contact is becoming unusual. ... Students will come to your office — rushing in from one activity, rushing off to the next — to find out what they need to do to get a better grade. Very few will seek you out to talk about ideas /Deresiewicz/15-08-15

    People are more likely to act less emotionally and more rationally when speaking their second language ... Moral decisions tend to be made using two thought processes—one subconscious, one conscious. ... Speaking in non-native languages can also free people from self-imposed moral limits. ... Speaking in a second language, may be one of the most moral things you can do. /15-08-15

    What kind of world is our code creating? ... Until we make contact with extraterrestrial intelligence, neural nets are probably the ablest non-human thinkers we know. ... Artificial systems show us intelligence spans a vast space of possibilities ... The problem isn’t just that machines think differently from people. It is that people can’t figure out why. ... computers, even though they’re performing tasks that we perform, are performing them in ways that are very different. ... pareidolia /15-08-10

    Neuroscience .. I ... you hear yourself talking: an autopilot version of yourself seems to have taken over. ... who is the 'I' that anxiously tries to regain control? ... is there still a single self, experienced from the outside? ... the 'split' dissolves quickly and you slip back into the driver's seat. ... depersonalization ... autism ... out-of-body experiences ... it questions the axiomatic certainty of the Cartesian 'I think, therefore I am'. ... paradox that the concept of self, often seen as elusive if not illusory, is so eminently suited to tightening these various narrative threads. /15-08-09

    Bioethics .. more harm than good ... self-reflection among ethicists ... from fetal stem cells to human gene editing, offer huge potential for treating disease. ... Steven Pinker .. ethical oversight delays innovation and offers little benefit. ... the future of biotechnologies is so difficult to accurately predict ... The primary moral goal for today’s bioethics can be summarized in a single sentence. Get out of the way. /15-08-09

    CLIMATE change puts humanity at risk. The Pope’s celebrated encyclical letter ... Perhaps for the first time in history, there seems to be a broad consensus among scientists. ... loss to society because of catastrophic climate change is so large that it cannot be reliably estimated. ... an illustrative figure of $336m billion as the cost of human extinction. ... the value of life of unborn generations ... the current inertia that climate negotiations suffer from. /15-07-30

    Faith and science ... Pope Francis has found a meeting place for those with extreme religious and environmentalist stances ... Pope has suggested that humans should not breed “like rabbits” ... Protestant conviction that God created natural resources for humans ... compromise between the extremes of the religious and environmentalist positions could also help to defuse other sources of tension between faith and science. ... Protestant churches: choose between science and faith. ... in the United States especially, atheism is over-represented among scientists ... respect for science is now divided along political lines too ... Pope Francis .. recognition that the economy and the environment are inextricably linked, especially for the desperately poor, builds on a foundation that is older and deeper than the recent US culture wars. /15-07-30

    The arrow of time ... why the universe started out so orderly ... The secret ingredient .. is gravity. ... two futures that share one past. ... the universe is eternal. ... all the particles would clump together into a homogeneous ball, a moment of minimum complexity. ... What we know as the universe could actually be just one of a pair ... gravity-driven arrow of time must have arisen. ... the Janus point /Julian Barbour/15-07-18

    The end of capitalism has begun ... information technology, new ways of working and the sharing economy. ... The old ways will take a long while to disappear, but it’s time to be utopian ... individualism replaced collectivism and solidarity ... reshaping the economy around new values and behaviours. I call this postcapitalism. ... hugely diminish the amount of work needed ... information is corroding the market’s ability to form prices correctly. ... The biggest information product in the world – Wikipedia – is made by volunteers for free ... in order to put a value on data, neither the cost of gathering it, nor the market value or the future income from it could be adequately calculated. ... Information goods are freely replicable. ... In the “Fragment” Marx imagines an economy ... “ideal machine”, which lasts forever and costs nothing. ... postcapitalism – whose precondition is abundance ... we can see their prefigurative forms in the lives of young people ... design of the postcapitalist world, as with software, can be modular. ... We need a project based on reason /15-07-18

    How We Decide Sam McNerney. ... Hard Problem ... recent wave of reductionist euphoria ... the radical subjectivity of experience. ... an organism has conscious mental states if and only if there is something that it is like to be that organism. ... Aesthetics will be propelled to the forefront of philosophy as a crucial part of metaphysical biology ... Humanities vs. STEM ... The humanities are in crisis. They’re dying. ... STEM—science, technology, engineering, mathematics—is now part of every university’s lingua franca. ... Empiricism Run Amok? ... The humanities touch the inner parts of our minds and souls the way technology cannot. ... into a post-human world. And that might sound great to logical positivists and atheists and neurobiologists. ... the BRAIN Initiative as a hubristic endeavor to reduce the beautiful messiness of humanistic creativity to the neatness of a mathematical equation. ... Science has brought us to the end of our childhood. ... Once we free ourselves of magical thinking ... Will the humanities sink under the weight of science? /15-07-16

    pentaquark particle spotted at CERN ... An exotic particle made up of five quarks has been discovered a decade after experiments seemed to rule out its existence. ... the forces that hold quarks together ... testing grounds for quantum chromodynamics (QCD) /15-07-16

    linking together animal brains with electrodes. ... At least some times, more brains are better than one, ... people to join together ... Surgeons might collectively operate on a single patient. ... exotic ethical quandaries ... Through trial and error, the rats learned how to consistently synchronize their brains, making it possible for the rats to act like a simple computer. ... neural privacy is something we should worry about, /15-07-16

    Computers can spot symptoms of depression psychiatrists may miss ... IEEE Transactions on Affective Computing ... analysis of depressed people’s speech .. facial expressions and eye movements ... uantifying what was previously a qualitative observation ... vowel-space ratio ... not yet proposing that their program replace psychiatrists. ... Working together, human and machine /15-07-13

    The Stanford Prison Experiment ... Professor Philip Zimbardo in 1971 ... randomly assigned roles of either ‘prison guard’ or ‘prisoner’ ... seemingly ordinary people can be manipulated by their environment into committing very bad acts. ... Isen and Levin found in 1972 that people who had just found a dime were 22 times more likely to help a woman who had dropped some papers than people who had not. ... situationism ... We create an illusion of freedom by attributing more internal control to ourselves, to the individual, than actually exists. ... What does it mean for ethics when moral behaviour appears to be largely governed by something outside ourselves? ... how is a virtue-centered ethical view plausible at all? ... biological determinism. One might go further and argue that, in the end, everything reduces to physical determinism anyway. ... before judging others .. we should realistically consider /15-07-07

    Lawsuits about what it means to be an employee could shape the future of big industries ... she was an employee rather than, as Uber claims, an independent contractor .. social security ... in America, as in many other rich countries, employment law has failed to keep up with the changing realities of modern work. ... “on-demand” economy ... Forcing McDonald’s to become a co-employer ... Uber’s number of drivers has been doubling every six months ... The last thing the country needs is for over-strict interpretations of outdated laws to kill exciting new businesses and sabotage jobs. /15-07-03

    Confirmation Bias - Test Your Awareness (Whodunnit?) YouTube/15-07-01

    Palaeontologists hope that software can construct fossil databases directly from research papers. ... DeepDive ... Text mining ... The machine is really clear about uncertainty ... to extract 192,000 opinions on the classification of taxonomic names ... It's a little scary, the machines are getting that good. ... research papers to be described more systematically in the future. /15-07-01

    benefits and risks of gene editing and artificial intelligence ... to modify human .. “unpredictable effects on future generations” and “profound implications for our relationship to nature” ... Concerns are coming from the silicon sector as well. Last year, the physicist Stephen Hawking proclaimed that rapidly advancing artificial intelligence (AI) could destroy the human race. ... When new technologies are introduced into complex socio-technical systems, everyone is ill-informed about the risks. ... Scientists are not elected. They cannot represent ... World Wide Views /15-06-30

    Super-muscly pigs created by small genetic tweak ... meaty pigs could become the first genetically engineered animals to be approved for human consumption ... ‘double-muscled’ pigs ... Kim used a gene-editing technology called a TALEN ... Rather than trying to create meat from such pigs, Kim and Yin plan to use them to supply sperm that would be sold to farmers for breeding with normal pigs. The resulting offspring, with one disrupted MSTN gene and one normal one, would be healthier, albeit less muscly, ... “I think China will go first,” says Kim. /15-06-30

    Software engineers at Google have been analyzing the 'dreams' of their computers. ... testing the ability of Google's servers to recognize and create images of commonplace objects ... artificial neural network is like a computer brain, .. reverse the process ... The computers have the ability to see images in objects in a way that artists can only dream of replicating. /15-06-26

    If Mars was the mother planet, Earth would have been the nurturing planet. ... The magnetosomes found in earthly bacteria and in the Martian meteorite ... Mars and Enceladus and other /15-06-19

    Schrödinger's cat ... warped space-time prevents quantum superpositions of large-scale objects. ... Somewhere in interstellar space it could be that the cat has a chance to preserve quantum coherence ... quantum physics applied to classical general relativity. In that way it doesn’t change our picture of the world /15-06-18

    The modern human rights movement turns 40 ... The language of human rights has become the lingua franca ... Solidarity in Poland, Charter 77 in Czechoslovakia, and the Moscow Helsinki Group /15-06-18

    the first direct proof of a metamorphosis between .. neutrinos — .. ‘muon’ and ‘tau’ ... OPERA (Oscillation Project with Emulsion-tracking Apparatus) at the Gran Sasso ... 730 kilometres ... It could have been six — or four, or three /15-06-17

    Pope Francis .. to limit climate change /Nature/15-06-16

    For five years I worked part-time for the poet and Nobel laureate Czesław Miłosz at his home in the Berkeley Hills. /15-06-16

    The Attack on Truth We have entered an age of willful ignorance ... only 53 percent of American adults knew how long it takes for Earth to revolve around the sun. ... ignorance coupled with the decision to remain ignorant. ... scientifically absurd postmodernist paper ... disbelief in climate change. ... Hugo Mercier and Dan Sperber .. to win arguments. .. the discovery of truth is only a byproduct. ... One likely candidate is the Internet. ... With the removal of editorial gatekeepers /15-06-14

    DO physicists need empirical evidence to confirm their theories? ... “sufficiently elegant and explanatory.” ... Higgs boson .. at the LHC marked the end of an era. ... We also can’t know how to truly understand the Big Bang, ... Are superstrings and the multiverse, .. anything more than modern-day epicycles? ... If the upgraded collider does discover supersymmetric particles, it will be an astonishing triumph of modern physics. But if nothing is found, ... /15-06-11

    ultra-elites are allowed to push the limits of human intelligence, while the less fortunate ... Increase concentration with Ritalin, for instance, and your creativity could suffer. ... But the day may come, .. personalized pills ... transcranial direct-current stimulation, ... deep-brain stimulation could also ensure that we remain smart for longer. ... And why stop at the Internet? A future mind could potentially connect directly to other future minds. ... not of stimulating the brain but of reengineering it. ... CRISPR ... engineering supersmart babies. ... our brains have evolved over millions of years and might already be at optimal neurochemical equilibrium, /15-06-10

    Computers Redefine the Roots of Math ... Voevodsky ... Coq ... the move to computer formalization is necessary because some branches of mathematics have become too abstract to be reliably checked by people. ... Set theory .. as a foundation .., but it can’t readily be translated into a form that computers can use ... Type theory .. Bertrand Russell ... to keep track of the various ways in which two objects .. are equivalent ... Infinity-groupoids encode all the paths in a space, including paths of paths, and paths of paths of paths. ... ideas from topology come into the very foundation of mathematics. ... univalent foundations /15-06-03

    We are the little epiphenomena that occur along the way from a simple low entropy past to a simple high entropy future. ... We don't know the right quantitative description for complexity. This is very early days. This is Copernicus, not even Kepler ... existential anxiety ... My own work is that of a traditional pencil and paper theorist. I own a computer. I mostly use it for email and looking at the Internet. ... the patterns in the microwave background, .. to take these clues that the universe is giving us and turn them into quantitative theories ... Feynman's desk ... The Bayesian Second Law of Thermodynamics. ... a book on quantum field theory or particle physics, words like cause and effect appear nowhere in the book. ... why notions of cause and effect work in the macroscopic world even though they're absent in the microscopic world, no one completely understands that. ... Part of that big region becomes our universe, ... the question is a combination of science and philosophy once again. ... string theory ... inaccessible to our practical experimental abilities. Maybe even our impractical ones ... ask Karl Popper about that, he would say these theories are perfectly scientific, .. He never said it would be easy to falsify things, ... ... Princess Elisabeth of Bohemia .. "You're a dualist" .. Descartes never found a satisfactory answer ... minds—consciousness—are not separate from the stuff out of which we are made. It is an emergent phenomenon, if you like. /Sean Carroll/15-06-02

    to look beyond the goal of merely making artificial intelligence more powerful. ... artificial intelligence that is “provably aligned” with human values. ... It might be that human values will forever remain somewhat mysterious. ... neuro-inspired learning algorithms ... There might be some bits and pieces left in the corners that the machine doesn’t understand or that we disagree on among ourselves. ... You see the behavior, and you’re trying to figure out what score that behavior is trying to maximize. ... that’s an incredible resource for machines to learn what human values are—who wins medals, ... Could you prove that your systems can’t ever, no matter how smart they are, overwrite their original goals as set by the humans? ... AI systems that rewrite themselves? /15-05-25

    The Anthropocene - with Jan Zalasiewicz /15-05-23

    faith and evolution and climate denial ... religious beliefs and the rejection of science ... religion has no conflict with science at all ... correlation between religiosity and less worry about climate change. ... atheists, agnostics, Buddhists, non-Orthodox Jews ... Southern Baptists, Pentecostals and other more conservative ... Catholics fall a bit below the zero line /15-05-23

    stan polskich szkół wyższych ... nikt nie chce przyznać, że jest głową, więc zapewne głowy po prostu nie ma. /ABBA/15-05-22

    In modern science, .. we've gotten used to the idea that science doesn't offer meaning in the way that institutional religions did in the past. .. this idea that modernity puts us in a world without meaning .. may be completely wrong. ... origin story .. It's full of meaning. ... a story that has a beginning, and of course, cosmologists are trying to look beyond that beginning. ... human language is more efficient. It's crossed a threshold beyond which information accumulates faster than it's lost. .. That is the foundation for explaining everything that makes us different. ... And of course, Godot never turns up. ... universe which can blindly create interesting and complex things. That's the story. ... the word "scientism" is just science with a pejorative loading. ... science is like all philosophical traditions. ... for science to present itself as meaningful, to present itself as being as meaningful as any other great philosophical tradition, and, in addition, much more powerful because it sums over so much more information. And it's global. ... mismatch between the big story which they get from their churches, and the science that created the iPhone ... Chomsky's idea of a slight neurological change that gave us grammar /David Christian/15-05-21

    The Myth of American Meritocracy ... How corrupt are Ivy League admissions? ... nearly half the students taking a Government course on the role of Congress had plagiarized or otherwise illegally collaborated on their final exam. ... The rise of a Henry Ford, from farm boy mechanic to world business tycoon, seems virtually impossible today, as even America’s most successful college dropouts such as Bill Gates and Mark Zuckerberg often turn out to be extremely well-connected former Harvard students. ... privileging the privileged ... Asian-Americans as the “New Jews” /15-05-21

    Sometimes it seems surprising that science functions at all. ... “Why most published research findings are false.” ... false or exaggerated ... consciously cherry-picking data to get their work published ... journal publication policies ... common modes of thinking that lure us toward wrong but convenient or attractive conclusions. ... Brian Nosek .. “motivated reasoning” ... Karl Popper ... “human factors” in the collection of statistics. ... “crisis of replicability” ... Journal referees might be inclined to reject negative results as too boring ... Open Science Framework (OSF) /15-05-20

    AI ... Powerful computers will reshape humanity’s future. ... The question is how to worry wisely. ... digital assistants will suggest promising hypotheses for academic research ... image-classification algorithms will allow wearable computers to layer useful information onto people’s views of the real world ... philosophers are still a long way from an understanding of how a mind might be made ... A car that drives itself better than its owner sounds like a boon; a car with its own ideas about where to go, less so. ... humans have been creating autonomous entities with superhuman capacities and unaligned interests for some time. Government bureaucracies, markets and armies: all can do things which unaided, unorganised humans cannot. ... the huge benefits from the dawn of AI. /15-05-08

    New Transparency ... non-believing clergy as “canaries in a coal mine.” ... we are now entering a really disruptive age in the history of human civilization, ... compare this to the Cambrian Explosion ... increased transparency of the ocean made eyesight possible, and this changed everything ... something similar is happening in human culture ... not just religions but also universities, ... there’s a place in the world for organizations that are bound together by tradition, by music and ceremony and texts /Daniel Dennett /15-05-07

    Chemistry That Led to Life on Earth ... not to build the ribose and the sugar units separately in textbook fashion, but to construct a substance that was part sugar and part base. ... The door to the RNA world had at last been opened. ... Life may still be unlikely, but at least it’s beginning to seem almost possible. /15-05-06

    Richard Dawkins, This Is My Vision Of "Life" ... if there is life elsewhere in the universe, it will be Darwinian life. I think there's only one way for this hyper complex phenomenon which we call "life" to arise from the laws of physics. ... it produces machines which can run, and walk, and fly, and dig, and swing through the trees, and think, and produce the whole of human technology, human art, human music. ... at some point in history, about 4 billion years ago, a replicating entity arose, ... the great majority of survival machines are actually discrete organisms, Edge /15-05-01

    In a world first, Chinese scientists have reported editing the genomes of human embryos. ... to reignite an ethical debate. ... to modify the gene responsible for ß-thalassaemia, a potentially fatal blood disorder ... Some say that gene editing in embryos could have a bright future because it could eradicate devastating genetic diseases before a baby is born. Others say that such work crosses an ethical line ... rejected by Nature and Science, in part because of ethical objections /15-04-28

    Neuroscience reveals the seemingly novel fact that “we are not the authors of our thoughts and actions in the way people generally suppose”. ... the brain’s chemistry consistently determines a decision prior to our consciously making that decision. ... This is a process not dissimilar to intuition, ... Our choices may be rooted in our physiology, our genetic makeup, but out of these arises something that was once called “character”, and it is this that is the final arbiter on choice. ... Character is the complex accumulation of our history ... the absence of the idea of a free will in antiquity. In its place is the notion of the good life /15-04-28

    About 2,500 years ago something changed the way humans think. ... rise to the world's major moral religions ... morality as a necessary social stabilizer in increasingly large and volatile human communities. ... recent study published in Current Biology point to a different factor: rising affluence. ... religions abruptly emerged when members of a population could reliably source 20,000 calories of energy a day ... with a steady energy supply, we had more time to cooperate, cultivate skills and consider consequences. /15-04-20

    Debunking of Moral Realism ... Sharon Street ... The argument begins from the empirical premise that evolutionary forces have influenced our moral beliefs, something that is plainly true, to a sceptical conclusion that our moral beliefs are unjustified. So the argument is essentially that since moral beliefs were not caused by moral facts, we have no reason to think that our moral beliefs could be true. ... What distinguishes the evolutionary debunker from other anti-realists is that she is not trying to show that there are no moral facts, but rather that there is no moral knowledge. ... natural selection are driven by fitness and survival, and truth doesn't enter the picture. ... Steven Pinker's towering work The Better Angels of our Nature /15-04-15

    We need new models of popular physics communication ... that clearly explains the mysteries of quantum mechanics to the layman would not be especially enlightening. ... Very, very few people lie at the intersection of "highly accomplished scientist" and "highly accomplished writer", and Dyson fits the bill ... Laura Fermi's delightful "Atoms in the Family" ... physics as poetry, physics as drama, physics as fiction, physics as comic characters /15-04-13

    Are We Really Conscious? OF the three most fundamental scientific questions about the human condition, two have been answered. First, what is our relationship to the rest of the universe? Copernicus answered that one. We’re not at the center. We’re a speck in a large place. Second, what is our relationship to the diversity of life? Darwin answered that one. Biologically speaking, we’re not a special act of creation. We’re a twig on the tree of evolution. Third, what is the relationship between our minds and the physical world? Here, we don’t have a settled answer. ... We have an awareness of information we process. What is this mysterious aspect of ourselves? ... a shift from a credulous and egocentric viewpoint to a skeptical and slightly disconcerting one: namely, that we don’t actually have inner feelings in the way most of us think we do. ... Patricia S. Churchland and Daniel C. Dennett. .. How does the brain go beyond processing information to become subjectively aware of information? The answer is: It doesn’t. ... And there is no way for the brain to determine through introspection that the story is wrong, because introspection always accesses the same incorrect information. ... Attention: a real, mechanistic phenomenon that can be programmed into a computer chip. Awareness: a cartoonish reconstruction of attention .. awareness is not an illusion. It’s a caricature. ... a system needs at least a rough model of the thing to be controlled. ... It’s best to be skeptical of intuition. (OCT. 10, 2014) /15-04-10

    number theory, algebra and string theory ... in particular dimensions, the first two of which were 1 and 196,883 ... j-function ... The monster has more than 1053 elements ... the universe has tiny hidden dimensions, too small to measure, ... Umbral Moonshine Conjecture ... K3 surfaces ... when we understand what moonshine is, it will be in terms of physics ... The string theory underlying umbral moonshine is likely to be “not just any physical theory, but a particularly important one,” ... connection between moonshine and quantum gravity ... 194 classes of black holes ... Umbral Moonshine Conjecture is “like looking for an animal on Mars and seeing its footprint, so we know it’s there,” /15-04-10

    252 million years ago .. carbon dioxide from volcanoes made sea water lethal ... pH levels dropped by about 0.7 units over 10,000 years /15-04-10

    Earth and Moon What if Theia and the proto-Earth already shared the same chemical composition? /15-04-10

    NASA is planning to deflect an asteroid in 2022 — to learn how to protect Earth ... crashing into an asteroid at more than 13,000 miles per hour ... binary system /15-04-09

    How Europeans evolved white skin ... modern Europeans don’t look much like those of 8000 years ago. ... By comparing key parts of the DNA /15-04-08

    whether time really passes? ... Parmenides believed the universe is the set of all moments at once. The entire history of the universe simply is. ... We have to be a little careful about what we mean by “time does not exist.” ... Time might instead emerge to play an important role in the macroscopic world of our experience, even if it is nowhere to be found in the final Theory of Everything. /Sean Carroll /15-04-07

    Amazon's 'Dash' Button ... designed for products that you buy repeatedly /15-04-07

    „neo-Darwinian synthesis” .. grounded on chemistry, and thereby on physics … For biology. Like geology but unlike chemistry, there is another problem. Living things are what they are not only because of the principles of physics, but also because of a vast number of historical accidents … “emergence” .. But it does not apply to everything .. we must have reference to deeper, more truly fundamental, principles of physics. … We do not know how long science will continue on this reductive path. … Steven Weinberg To Explain the World /15-04-06

    Dark matter is the simplest solution to the complex observations. ... Nothing would be something, but so far nothing—nothing has been seen. ... Weakly Interacting Massive Particle or WIMP. ... neutralino which is the supersymmetry partner of the neutrino. ... We will never grasp dark matter in our hands no matter how long we wait. /15-03-30

    The Renaissance vision of Jerome (c. 347-420 AD), as depicted by Albrecht Dürer in a world-famous engraving of 1514, seems to represent an ideal type of the scholar: secluded in the desert, far removed from the bustle of ordinary life (with a lion to prove it), well-established in his institution (as shown by the cardinal’s hat), and devoted to his studies. /15-03-28

    But if one thinks a priori that theism is extremely improbable, then the historical evidence for the Resurrection would be discounted and not lead to a high posterior probability for theism. /15-03-27

    The world is going to university ... The modern research university, a marriage of the Oxbridge college and the German research institute, was invented in America ... well-funded institutions at the top and poorer ones at the bottom. ... The world is moving in the American direction. ... 19 of the 20 universities in the world that produced the most highly cited research papers were American. But on the educational side, the picture is less clear. ... university education is too complex to be measured ... testing 22-year-olds is harder than testing 12-year-olds. ... universities should be able to show that they have taught their students to think critically. /15-03-26

    origin-of-life ... The crash of meteors on early Earth likely generated hydrogen cyanide, which could have kick-started the production of biomolecules needed to make the first cells. ... In order for life to have gotten started, there must have been a genetic molecule—something like DNA or RNA—capable of passing along blueprints for making proteins, the workhorse molecules of life. ... HCN .. H2S.. and ultraviolet (UV) light. /15-03-20

    wystarczy choćby wspomnieć kompletnie bezsensowne Krajowe Ramy Kwalifikacji - Andrzej Białas, Prezes PAU do Krzysztofa Kwiatkowskiego, Prezesa NIK /15-03-19

    Robots ... programming, too, will be outsourced to machines ... While these machines cannot think, per se, ... What is a social robot? .. “it’s a robot with a little humanity.” ... systems that can learn or acquire values at run-time. /15-03-18